Insert HTML here
Showing 3057–3072 of 3705 results
Product Name (Gly14)-Humanin (human) Biological activity (Gly14)-Humanin (human) (14-Glycine-Humanin (human)) is an analog of Humanin in which the 14th amino acid serine was replaced with glycine (Gly). (Gly14)-Humanin (human) has anti-apoptotic and neuroprotective functions. Molecular Weight 2657.21 Formula Formula C118H202N34O31S2 CAS Number 330936-70-4 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening MAPRGFSCLLLLTGEIDLPVKRRA Storage…
Product Name Urocortin, rat TFA Biological activity Urocortin, rat TFA (Urocortin (Rattus norvegicus) TFA) is a neuropeptide and a potent endogenous CRFR agonist with Kis of 13 nM, 1.5 nM, and 0.97 nM for human CRF1, rat CRF2α and mouse CRF2β, respectively. Molecular Weight 4821.28 Formula Formula C208H339N62F3O66 Sequence Shortening Sequence Shortening DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 Storage Please…
Product Name Obestatin(rat) TFA Biological activity Obestatin(rat) TFA, encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) TFA suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) TFA has anti-inflammatory, anti-myocardial infarction and antioxidant activities. CAS Number…
Product Name Galanin (1-29)(rat, mouse) Biological activity Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect. CAS Number 114547-31-8 Sequence Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 Sequence Shortening Sequence Shortening GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 Storage Please store the product under the recommended conditions in the Certificate…
Product Name Nesfatin-1 (24-53), mouse/rat Biological activity Nesfatin-1 (24-53), mouse/rat is a peptide. Nesfatin-1 (24-53), mouse/rat significantly decreases food intake, inhibits gastroduodenal motility. Sequence Sequence Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2 Sequence Shortening Sequence Shortening PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in…
Product Name Orexin A (human, rat, mouse) Biological activity Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A…
Octreotide acetate, a long-acting synthetic analog of native somatostatin, inhibits growth hormone, glucagon, and insulin more potently. Product Information Product Name Octreotide acetate Molecular Weight 1079.29 Formula C51H70N10O12S2 CAS Number 79517-01-4 Appearance Solid Color White to off-white Sequence {d-Phe}-Cys-Phe-{d-Trp}-Lys-Thr-{Cys(X)}-{Thr(deoxy)} (disulfide bridge: Cys2-Cys7) (X=N-(1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl) Sequence Shortening {d-Phe}-CF-{d-Trp}-KY-{Cys(X)}-{Thr(deoxy)} (disulfide bridge: Cys2-Cys7) (X=N-(1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl) Storage Sealed storage, away from…
Octreotide (SMS 201-995) hydrochloride is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide hydrochloride can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide hydrochloride increases Gi activity and reduces intracellular cAMP production. Octreotide hydrochloride has antitumor activity, mediates apoptosis and may also be used in disease…
OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissues of Ophiophagus hannah (king cobra). Product Details Product Name OH-CATH Biological activity OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissue of Ophiophagus hannah (King Cobra). Sequence Lys-Arg-Phe-Lys-Lys-Phe-Phe-Lys-Lys-Leu-Lys-Asn-Ser-Val-Lys-Lys-Arg-Ala-Lys-Lys-Phe-Phe-Lys-Lys-Pro-Arg-Val-Ile-Gly-Val-Ser-Ile-Pro-Phe Sequence Shortening KRFKKFFKKLKNSVKKRAKKFFKKPRVIGVSIPF Storage Please store…
Omiganan is a cationic antimicrobial peptide. Omiganan as an analogue of indolicidin shows activity against gram-positive and gram-negative bacteria but also Candida spp. isolates. Omiganan can be used for the research of alcohol nose and acne. Product Information Product Name Omiganan Molecular Weight 1779.15 Formula C90H127N27O12 CAS Number 204248-78-2 Appearance Solid Color Off-white to light…
Omiganan is a cationic antimicrobial peptide. As an analog of indolicidin, Omiganan inhibits both Gram-positive and Gram-negative bacteria, as well as Candida species. Omiganan can be used in research on rosacea and acne. Product Details Product Name Omiganan Biological activity Omiganan is a cationic antimicrobial peptide. Omiganan as an analogue of indolicidin shows activity against…
Omiganan pentahydrochloride is a cationic peptide compound with a broad antibacterial spectrum. Omiganan pentahydrochloride inhibits a variety of bacteria including yeast, with killing activity against both Gram-positive and Gram-negative bacteria. Omiganan pentahydrochloride can interact with bacterial cell membranes, leading to membrane disruption and bacterial death. Omiganan pentahydrochloride can be used in research on antibacterial activity…
Omiganan, FITC labeled is a peptide-FITC conjugate composed of Omiganan and FITC. Omiganan is a cationic peptide with antibacterial and antifungal activity that can be used as a topical gel for the prevention of catheter-related infections. FITC is a fluorescein derivative used for labeling primary amines. Product Details Product Name Omiganan, FITC labeled Biological activity…
Omiganan, FITC labeled TFA is a peptide-FITC conjugate composed of Omiganan and FITC. Omiganan is a cationic peptide with antibacterial and antifungal activity that can be used as a topical gel for the prevention of catheter-related infections. Product Details Product Name Omiganan, FITC labeled TFA Biological activity Omiganan, FITC labeled TFA is a peptide-FITC complex…
Omphalotin A is a cyclic peptide with nematicidal activity. Product Details Product Name Omphalotin A Biological activity Omphalotin A is a cyclic peptide, and shows nematicidal activity. Appearance Solid Color White to off-white Sequence Cyclo({Ile(Me)}-{Sar}-Trp-{Val(Me)}-Ile-{Val(Me)}-{Val(Me)}-{Sar}-{Val(Me)}-{Ile(Me)}-{Sar}-Val) Sequence Shortening Cyclo({Ile(Me)}-{Sar}-W-{Val(Me)}-I-{Val(Me)}-{Val(Me)}-{Sar}-{Val(Me)}-{Ile(Me)}-{Sar}-V) Storage Sealed storage, away from moisture
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us