Insert HTML here
Showing 225–240 of 3705 results
Product Name Angiotensin III antipeptide Biological activity Angiotensin III antipeptide is a peptide antibiotic. CAS Number 133605-55-7 Sequence Sequence Gly-Val-Tyr-Val-His-Pro-Val Sequence Shortening Sequence Shortening GVYVHPV Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Beta-Lipotropin (1-10), porcine Biological activity Beta-Lipotropin (1-10), porcine is a porcine-derived fragment of β-lipotropin (1-10), which is a porcine. CAS Number 77875-68-4 Sequence Sequence Glu-Leu-Ala-Gly-Ala-Pro-Pro-Glu-Pro-Ala Sequence Shortening Sequence Shortening ELAGAPPEPA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name GHRF, ovine Biological activity GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH). Formula Formula C221H368N72O66S CAS Number 94948-82-0 Sequence Shortening Sequence Shortening YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Product Name ACTH (7-38) (human) Biological activity ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity. CAS Number 68563-24-6 Appearance Solid Color White to off-white Sequence Sequence Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu Sequence Shortening…
Product Name (Des-Gly10,D-Leu6,Orn8,Pro-NHEt9)-LHRH Biological activity (Des-Gly10,D-Leu6,Orn8,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1051970-61-6 Sequence Sequence…
Product Name pTH (28-48) (human) Biological activity pTH (28-48) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Acetyl-ACTH (7-24) (human, bovine, rat) Biological activity Acetyl-ACTH (7-24) (human, bovine, rat) causes a marked decrease of ACTH-evoked corticosterone and aldosterone release. CAS Number 1815618-01-9 Sequence Sequence Ac-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening Ac-FRWGKPVGKKRRPVKVYP Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Kisspeptin-54 (27-54) (human) Biological activity Kisspeptin-54 (27-54) (human) is a polypeptide that can be used for compound synthesis and pharmaceutical research. CAS Number 1135442-77-1 Sequence Sequence Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 Sequence Shortening Sequence Shortening IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment of the Streptococcus mutans cell surface adhesin that can serve as an antimicrobial peptide, specifically inhibiting the binding of adhesin to salivary receptors and preventing recolonization of S. mutans. Product Details Product Name Acetyl-Adhesin (1025-1044) amide Biological activity Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment of Streptococcus pyogenes…
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-MKLGTWTYDGSVV-OH Specifications: 13mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-IIGTLAVFAGRLIELNQQG-OH Specifications: 19mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-QIVTTNVRLKQQWVDYNLKW-OH Specifications: 20mer peptide as TFA salt
Amount: 1 microarray (1″ x 3″) Application: Enzymology Category: Enzyme Substrate Arrays Condition / Topic: Acetyltransferase, Deacetylase, Epigenetics Layout: 1-sample peptide microarray, 21-sample peptide microarray Organism: Human Protein Name: Selected proteins Quantification: No Sequence: See Sequence List under Product Documentation Specifications: 13 mer peptides selected form the human proteome
Amount: 1 microarray (1″ x 3″) Application: Enzymology Category: Enzyme Substrate Arrays Condition / Topic: Acetyltransferase, Deacetylase, Epigenetics Layout: 1-sample peptide microarray, 21-sample peptide microarray Organism: Human Protein Name: Selected proteins Quantification: No Sequence: See Sequence List under Product Documentation Specifications: 13 mer peptides selected form the human proteome
Aclerastide (DSC-127) is an angiotensin receptor agonist. Aclerastide also is a peptide analog of angiotensin II. Aclerastide can be used for the research of tissue regeneration in diabetic ulcers. Product Information Product Name Aclerastide Molecular Weight 913.03 Formula C42H64N12O11 CAS Number 227803-63-6 Appearance Solid Color White to off-white Sequence Asp-Arg-{Nle}-Tyr-Ile-His-Pro Sequence Shortening DR-{Nle}-YIHP Storage Sealed…
AcrAP1 (AP1-Z1) is an antimicrobial peptide present in the venom of the Arabian scorpion (Androctonus crassicauda). AcrAP1 has antibacterial activity and inhibits the growth of Gram-positive bacteria, Gram-negative bacteria, and yeast. AcrAP1 exerts anti-tumor activity by promoting apoptosis of cancer cells and inhibiting angiogenesis. AcrAP1 can be used in cancer research. Product Details Product Name…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us