Insert HTML here
Showing 1825–1840 of 3705 results
Human ??-defensin 5 is an antiviral peptide. Human ??-defensin 5 blocks infection by non-enveloped viruses, including AdV, HPV, and polyomavirus (IC50: 0.6-1.25 ??M against HPV16). Human ??-defensin 5 can bind to viral capsids and prevent virus escape from endosomes. Human ??-defensin 5 increases the binding of HIV to the cell surface. Human ??-defensin 5 also…
Human ??-Defensin 6 is a cysteine-rich peptide containing 32 residues that inhibits bacterial invasion and contributes to mucosal immunity. Human ??-Defensin 6 forms ordered self-assembled fibrils and nanonets that surround and entangle bacteria after random binding to bacterial surface proteins. Human ??-Defensin 6 also inhibits Candida albicans biofilm formation. Product Details Product Name Human ??-Defensin…
Human ??-defensin-1 (H??D-1) is an antimicrobial peptide and immunomodulator that induces fibroblasts to secrete angiogenin through EGFR, JNK, NF-??B, Src, and p38 signaling pathways, and binds CCR6 to activate G protein signaling, while also inducing ER stress, apoptosis, cell cycle arrest, and autophagy. Human ??-defensin-1 can be used in research on hepatocellular carcinoma, influenza A…
Human ??-defensin-2 (H??D-2) is an orally active, cysteine-rich antimicrobial peptide secreted by epithelial cells, with antibacterial, antiviral, and immunomodulatory activities. Human ??-defensin-2 binds CCR2, reduces NF-??B phosphorylation, increases CREB phosphorylation, inhibits pro-inflammatory cytokines, induces IL-10, and chemoattracts immune cells via CCR2/CCR6. Human ??-defensin-2 reduces smoke-induced pulmonary neutrophilia in mice, downregulates pulmonary pro-inflammatory signaling, promotes bacterial…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Human Protein Name: Actin Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification:…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Epithelium Layout: Freeze-dried in glass vial Organism: Human Protein Name: Actin Purity: >70% (HPLC-MS), Development Grade: each peptide purified to…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Alpha-fetoprotein Purity: >70% (HPLC-MS), Development Grade: each peptide purified to >…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Alzheimer’s disease, Neurodegeneration Layout: Freeze-dried in glass vial Organism: Human Protein Name: Alpha-Synuclein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Specifications:…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Alzheimer’s disease, Autoimmune disease, Cancer, Neurodegeneration Layout: Freeze-dried in glass vial Organism: Human Protein Name: Aquaporin-4 Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Brachyury Mutation, Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Transcription factors/activators Purity: >70% (HPLC-MS), Development Grade: each peptide…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Serine/threonine-protein kinase B-raf Purity: >70% (HPLC-MS), Development Grade: each peptide purified…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Epithelium Layout: Freeze-dried in glass vial Organism: Human Protein Name: Carcinoembryonic antigen-related cell adhesion molecule 5 Purity: >70% (HPLC-MS), Development…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Blood coagulation Layout: Freeze-dried in glass vial Organism: Human Protein Name: Coagulation factor VIII Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: F5/8…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Blood coagulation Layout: Freeze-dried in glass vial Organism: Human Protein Name: Coagulation factor VIII Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: F5/8…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Cystic Fibrosis, Epithelium, Respiratory infection Layout: Freeze-dried in 2 glass vials Organism: Human Protein Name: Cystic fibrosis transmembrane conductance regulator Purity: Development Grade: each peptide purified to >…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Epithelium Layout: Freeze-dried in glass vial Organism: Human Protein Name: Claudin-6 Purity: >70% (HPLC-MS), Development Grade: each peptide purified to…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us