Human ??-defensin-1
Description
Human ??-defensin-1 (H??D-1) is an antimicrobial peptide and immunomodulator that induces fibroblasts to secrete angiogenin through EGFR, JNK, NF-??B, Src, and p38 signaling pathways, and binds CCR6 to activate G protein signaling, while also inducing ER stress, apoptosis, cell cycle arrest, and autophagy. Human ??-defensin-1 can be used in research on hepatocellular carcinoma, influenza A virus infection, male infertility, colon cancer, and bacterial infections caused by antibiotic-resistant strains.
Product Details
| Product Name | Human ??-defensin-1 |
| Biological activity | Human ??-defensin-1 (H??D-1) is an antimicrobial peptide and immunomodulator that induces angiogenin secretion from fibroblasts through EGFR, JNK, NF-??B, Src, and p38 signaling pathways, and binds CCR6 to activate G protein signaling, while also inducing ER stress, apoptosis, cell cycle arrest, and autophagy. Human ??-defensin-1 can be used in research on hepatocellular carcinoma, influenza A virus infection, male infertility, colon cancer, and bacterial infections caused by antibiotic-resistant strains. |
| Formula | C167H256N48O50S6 |
| CAS Number | 452274-53-2 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridge:Cys5-Cys34; Cys12-Cys27; Cys17-Cys35) |
| Sequence Shortening | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge:Cys5-Cys34; Cys12-Cys27; Cys17-Cys35) |
| Storage | Sealed storage, away from moisture and light |
