Insert HTML here
Showing 689–704 of 883 results
Product Name Substance P-Gly-Lys-Arg Biological activity Substance P-Gly-Lys-Arg, also known as β-Preprotachykinin (58-71), is an analog of Substance P (HY-P0201). CAS Number 123148-51-6 Sequence Shortening Sequence Shortening RPKPQQFFGLMGKR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Biotinyl-neuropeptide W-23 (human) Biological activity Biotinyl-neuropeptide W-23 (human) is a biotinylated Neuropeptide W-23 (human) (HY-P1035). Neuropeptide W-23 (human) is an agonist of NPBW1 (GPR7) and NPBW2 (GPR8). CAS Number 1815618-09-7 Appearance Solid Color White to off-white Sequence Sequence Biotin-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu Sequence Shortening Sequence Shortening Biotin-WYKHVASPRYHTVGRAAGLLMGL Storage Sealed storage, away from moisture Powder -80??C 2…
Product Name (Glu17,21,24)-Osteocalcin (1-49) (human) Biological activity (Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism. CAS Number 1927927-11-4 Appearance Solid Color White to off-white Sequence Sequence Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val (Disulfide bridge: Cys23-Cys29) Sequence Shortening Sequence Shortening YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge: Cys23-Cys29) Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C…
Product Name Adrenomedullin (AM) (13-52), human Biological activity Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent. Formula Formula C200H308N58O59S2 CAS Number 154765-05-6 Appearance Solid Color White to off-white Sequence Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9) Sequence Shortening Sequence Shortening SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys4-Cys9) Storage Sealed storage, away…
Product Name Neuromedin U, rat Biological activity Neuromedin U, rat is a 23-amino acid brain-gut peptide. Neuromedin U (NMU), through its cognate receptor NMUR2 in the central nervous system, regulates several important physiological functions, including energy balance, stress response, and nociception. Molecular Weight 2642.97 Formula Formula C124H180N34O31 CAS Number 117505-80-3 Sequence Sequence Tyr-Lys-Val-Asn-Glu-Tyr-Gln-Gly-Pro-Val-Ala-Pro-Ser-Gly-Gly-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 Sequence Shortening…
Product Name Orexin A (human, rat, mouse) TFA Biological activity Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)) TFA, a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) TFA binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor…
Product Name Pancreatic Polypeptide, bovine Biological activity Pancreatic Polypeptide, bovine, a 36-amino acid, straight chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4. Molecular Weight 4225.78 Formula Formula C186H287N53O56S2 CAS Number 179986-89-1 Sequence Sequence Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence…
Product Name Pancreatic polypeptide Biological activity Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion. Molecular Weight 4182.7 Formula Formula C185H286N52O55S2 CAS Number 59763-91-6 Appearance Solid Color White to off-white Sequence Sequence Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence Shortening Sequence…
Product Name Neuropeptide Y (18-36) (porcine) Biological activity Neuropeptide Y (18-36) (porcine) is a competitive neuropeptide Y (NPY) cardiac receptor antagonist. Neuropeptide Y (18-36) (porcine) inhibits the binding of I-NPY to cardiac ventricular membranes in a concentration-dependent manner with an IC50 value of 158 nM and an Ki value of 140 nM. Neuropeptide Y (18-36)…
Product Name Obestatin(human) Biological activity Obestatin(human) is a 23-amino acid amidated peptide that regulates appetite and gastrointestinal motility via its interaction with GPR39. Obestatin(human) can be used for weight loss. Obestatin(human) cannot penetrate the cell membrane. Molecular Weight 2546.86 Formula Formula C116H176N32O33 CAS Number 1081110-72-6 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening…
Product Name Sauvagine Biological activity Sauvagine is a corticotropin-releasing factor receptor (CRFR) agonist. Sauvagine activates HM-CRF receptors to stimulate intracellular cAMP accumulation, activates PC-CRF receptors to trigger associated signaling pathways, and stimulates the hypothalamic-pituitary-adrenal axis. Sauvagine can be used for research on central nervous system and blood diseases. Molecular Weight 4599.31 Formula Formula C202H346N56O63S CAS…
Product Name Leptin (93-105), human Biological activity Leptin (93-105), human, is the amino acids 93 to 105 fragment of human leptin. Leptin is a 167-residue peptide hormone mainly produced by adipocytes and acts in the central nervous system to primarily coordinate the metabolic adaptations to fasting. CAS Number 200436-43-7 Appearance Solid Color White to off-white…
Product Name Neurokinin A Biological activity Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues. Molecular Weight 1133.32 Formula Formula C50H80N14O14S CAS Number 86933-74-6 Appearance Solid Color White to off-white Sequence Sequence His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Sequence Shortening…
Product Name Adrenocorticotropic hormone (1-39), rat Biological activity Adrenocorticotropic hormone (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist. Molecular Weight 4582.23 Formula Formula C210H315N57O57S CAS Number 77465-10-2 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Product Name [Glu4]-Oxytocin Biological activity -Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of ??oxytocin-like?? molecules in aqueous solution. CAS Number 4314-67-4 Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening CYIENCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed storage,…
Product Name Neuropeptide S(Rat) Biological activity Neuropeptide S (Rat) is an endogenous ligand of a previously orphan G-protein-coupled receptor now named NPS receptor. Neuropeptide S (Rat) can be used for the research of nervous system disease. CAS Number 412938-75-1 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening SFRNGVGSGVKKTSFRRAKQ Storage Sealed storage, away from…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us