Product Name Peptide YY (PYY) (3-36), porcine Biological activity Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite. Molecular Weight 3980.42 Formula Formula C176H272N52O54 CAS Number 126339-09-1 Sequence Sequence Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 Storage Please store the product under the recommended conditions…
Product Name ACTH (34-39) Biological activity ACTH (34-39) is an adrenocorticotropic hormone fragment. ACTH (34-39) can be used in the study of stress-related sleep disorders. Formula Formula C37H50N6O9 CAS Number 69454-10-0 Appearance Solid Color White to off-white Sequence Sequence Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening AFPLEF Storage Sealed storage, away from moisture Powder -80??C 2 years…
Product Name Neuropeptide W-30 (rat) Biological activity Neuropeptide W-30 (rat) is an important stress mediator in the central nervous system that modulates the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. Neuropeptide W-30 (rat) is an endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8. NPW-30 activates and binds to both GPR7…
Product Name cCF10 Biological activity cCF10 is a peptide sex pheromone. cCF10 induces transfer of the conjugative plasmid pCF10 from plasmid-containing donor cells to plasmid-free recipient cells. cCF10 induces Opp system and enters bacterial cells to inhibit (p)ppGpp accumulation. cCF10 reduces persister cell generation via maintaining the metabolically active state of bacteria. CAS Number 116355-81-8…
Product Name δ-MSH Biological activity δ-MSH is a melanocortin peptide. δ-MSH is a weak melanocortin receptor (MCRs) ligand. CAS Number 100930-04-9 Sequence Sequence Ser-Met-Glu-Val-Arg-Gly-Trp Sequence Shortening Sequence Shortening SMEVRGW Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Octadecaneuropeptide Biological activity Octadecaneuropeptide is an 18-residue peptide. Octadecaneuropeptide can be derived from Diazepam binding inhibitor. Octadecaneuropeptide includes a specific ligand for the gamma-aminobutyric acid receptor regulatory site occupied by beta-carbolines. Octadecaneuropeptide elicits a dose-related facilitation of the punishment-elicited suppression of drinking. CAS Number 95237-86-8 Sequence Sequence Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu-Lys Sequence Shortening Sequence Shortening QATVGDVNTDRPGLLDLK…
Product Name Corazonin Biological activity Corazonin is a highly conserved neuropeptide hormone of wide-spread occurrence in insects, serves a central regulator of caste identity and behavior in social insects. Corazonin is also preferentially expressed in workers and/or foragers from other social insect species. Molecular Weight 1370.42 Formula Formula C62H83N17O19 CAS Number 122929-08-2 Sequence Shortening Sequence…
Product Name [Ala2] Met-Enkephalinamide Biological activity Met-Enkephalinamide is an active peptide. Met-Enkephalinamide can be used for the research of various biochemical studies. CAS Number 64240-07-9 Sequence Shortening Sequence Shortening YAGFM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Small Cardioactive Peptide B (SCPB) Biological activity Small Cardioactive Peptide B (SCPB), a neurally active peptide, stimulates adenylate cyclase activity in particulate fractions of both heart and gill tissues with EC50s of 0.1 and 1.0 ??M, respectively. Molecular Weight 1141.41 Formula Formula C52H80N14O11S2 CAS Number 84746-43-0 Appearance Solid Color White to off-white Sequence…
Product Name GLP-1(7-36), amide TFA Biological activity GLP-1(7-36), amide TFA is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Molecular Weight 3297.63 (free base) Formula Formula C149H226N40O45.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Storage Sealed storage, away from moisture and light Powder -80??C…
Product Name Acyline Biological activity Acyline, a GnRH peptide analogue, is a GnRH antagonist that inhibits gonadotropin and testosterone (T) levels. Molecular Weight 1533.21 Formula Formula C80H102ClN15O14 CAS Number 170157-13-8 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months;…
Product Name Cardioexcitatory peptide 1 Biological activity Cardioexcitatory peptide 1 is a cardioexcitatory neuropeptide, can be isolated from Achatina atria. Cardioexcitatory peptide 1 has potent cardio-excitatory action on the hearts and also modifies the motility of muscular tissues and neural activities. Formula Formula C57H85N21O15 CAS Number 127122-98-9 Sequence Shortening Sequence Shortening SGQSWRPQGRF-NH2 Storage Please store…
Product Name ACTH (6-9) Biological activity ACTH (6-9) (MSH-ACTH tetrapeptide) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. Formula…
Product Name VIP(Guinea pig) Biological activity VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function. Formula Formula C147H239N43O42S2 CAS Number 96886-24-7 Appearance Solid Color White to off-white Sequence Sequence His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 Sequence Shortening…
Product Name Obestatin(rat) Biological activity Obestatin(rat), encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) has anti-inflammatory, anti-myocardial infarction and antioxidant activities. CAS Number 869705-22-6 Appearance Solid Color…
Product Name Brain Natriuretic Peptide-45, mouse Biological activity Brain Natriuretic Peptide-45, mouse (BNP-45, mouse) is a 45-amino-acid peptide derived from the mouse BNP prohormone, which exhibits natriuretic, diuretic, and vasoactive effects. Brain Natriuretic Peptide-45, mouse contains all amino acid residues deemed critical for the biological activity of natriuretic peptides. Brain Natriuretic Peptide-45, mouse possesses hypotensive…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
