Product Name CART(55-102)(human) TFA Biological activity CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y. Sequence Sequence Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name GLP-2(rat) Biological activity GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Formula Formula C166H256N44O56S CAS Number 195262-56-7 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp Sequence Shortening Sequence Shortening HADGSFSDEMNTILDNLATRDFINWLIQTKITD Storage…
Product Name CART(55-102)(rat) TFA Biological activity CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior. Sequence Sequence Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Please store the product under the recommended…
Product Name Endothelin (16-21) Biological activity Endothelin (16-21) is a selective ETB receptor agonist (EC50=228 nM in guinea-pig bronchus). Endothelin (16-21) can induce smooth muscle contraction. Endothelin (16-21) is promising for research of respiratory (e.g., asthma) and cardiovascular (e.g., hypertension) diseases. CAS Number 121377-67-1 Sequence Sequence His-Leu-Asp-Ile-Ile-Trp Sequence Shortening Sequence Shortening HLDIIW Storage Please store…
Product Name me4 Peptide Biological activity me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders. Sequence Sequence Ac-Ala-Arg-Thr-Tyr-Gly-Arg-Arg-Arg-Gly-Ser-Gly-Ser-Gly-Ser-Ala-Arg-Thr-Tyr-Gly-Arg-Arg-Arg-NH2 Sequence Shortening Sequence Shortening Ac-ARTYGRRRGSGSGSARTYGRRR-NH2 Storage Please store the…
Product Name CART (55-76), rat Biological activity CART (55-76), rat is a neuropeptide (55-76 residues of the CART peptide) and constitutes the N-terminal fragments of CART (55-102). CART (55-76), rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (55-76), rat can induce anxiety and…
Product Name CART (1-39), Human Biological activity CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART…
Product Name [Lys0]γ1-MSH Biological activity γ1-MSH is a γ1-melanotropin-like peptide, one of 1600-dalton γ-MSHs. γ1-MSH can be isolated from bovine neurointermediate pituitary lobes. Formula Formula C78H109N23O15S CAS Number 78859-45-7 Sequence Shortening Sequence Shortening KYVMGHFRWDRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name ACTH (1-17) Biological activity ACTH (1-17), an adrenocorticotropin analogue, is a potent human melanocortin 1 (MC1) receptor agonist with a Ki of 0.21 nM. Molecular Weight 2093.41 Formula Formula C95H145N29O23S CAS Number 7266-47-9 Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKR Storage Please store the product under the recommended conditions in the Certificate…
Product Name Gastric Inhibitory Peptide, porcine Biological activity Gastric Inhibitory Peptide (GIP (1-42)), porcine is a porcine glucose-dependent insulinotropic polypeptide and inhibitor of pentagastrin-stimulated gastric acid secretion. Gastric Inhibitory Peptide, porcine stimulates endogenous somatostatin release. Gastric Inhibitory Peptide, porcine acts in a dose- and time-dependent manner in conscious, chronic gastric fistula-equipped rats. Formula Formula C225H342N60O66S…
Product Name CART (61-102) (rat) Biological activity CART (61-102) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Oxyntomodulin (bovine, porcine) Biological activity Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist. Formula Formula C192H295N59O60S CAS Number 62340-29-8 Appearance Solid Color White to off-white Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala Sequence Shortening Sequence Shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Product Name Orexin B, rat, mouse TFA Biological activity Orexin B, rat, mouse (Rat orexin B) TFA is an endogenous orexin receptor agonist. Orexin B, rat, mouse TFA binds and activates two closely related orphan G protein-coupled receptors OX1-R and OX2-R. Orexin B, rat, mouse TFA stimulates food intake and energy expenditure and plays a…
Product Name CCK (26-31) sulfated Biological activity CCK (26-31) (sulfated) is the N-terminal fragment of CCK, a peptide hormone found in the gut and brain that stimulates digestion, regulates satiety, and is associated with anxiety. CAS Number 89911-65-9 Appearance Solid Color White to off-white Sequence Sequence Ac-Asp-{Tyr(SO3H)}-Met-Gly-Trp-Met-NH2 Sequence Shortening Sequence Shortening Ac-D-{Tyr(SO3H)}-YMGWM-NH2 Storage Sealed storage,…
Product Name SALMF amide 1 Biological activity SALMF amide 1 is a neuropeptide. CAS Number 134439-73-9 Sequence Shortening Sequence Shortening GFNSALMF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Calcitonin (salmon) acetate Biological activity Calcitonin (salmon) (acetate)?is a dual-action amylin and calcitonin?receptor agonist, can stimulate bone formation and inhibit bone resorption.The acetate form can affect the absorption and efficacy of hormones. Formula Formula C145H240N44O48S2.xC2H4O2 CAS Number 158000-61-4 Appearance Solid Color White to off-white Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
