Product Name Ebiratide Biological activity Ebiratide (HOE-427 free base) is an ACTH 4-9 derivative, which acts directly on the central nervous system and exhibits memory-enhancing efficacy. Ebiratide enhances acetycholine (ACh) metabolism in rat brain. Formula Formula C48H73N11O10S CAS Number 105611-68-5 Sequence Sequence {Met(O2)}-Glu-His-Phe-{d-Lys}-{Phe-NH(CH2)8NH2} Sequence Shortening Sequence Shortening {Met(O2)}-EHF-{d-Lys}-{Phe-NH(CH2)8NH2} Storage Please store the product under the…
Product Name [His7] Corazonin Biological activity Corazonin, a neurohormone, induces dark color in the cuticle and epidermis of Locusta migratoria. CAS Number 138968-27-1 Sequence Shortening Sequence Shortening Glp-TFQYSHGWTN-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P (7-11) Biological activity Substance P (7-11) is a C-terminal fragment of Substance P which can cause an increase in the intracellular calcium concentration. Formula Formula C31H44N6O5S CAS Number 51165-05-0 Appearance Solid Color White to off-white Sequence Sequence Phe-Phe-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening FFGLM-NH2 Storage Sealed storage, away from moisture and light…
Product Name GLP-1(7-36), amide acetate Biological activity GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Molecular Weight 3297.64 (free base) Formula Formula C149H226N40O45.xC2H4O2 CAS Number 1119517-19-9 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Product Name Metamorphosin A Biological activity Metamorphosin A is a neuropeptide that can be isolated from Anthopleura elegantissima. Metamorphosin A triggers metamorphosis in Hydractinia echinata. CAS Number 157622-03-2 Sequence Sequence {Pyr}-Gln-Pro-Gly-Leu-Trp-NH2 Sequence Shortening Sequence Shortening {Pyr}-QPGLW-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Acetyl neurotensin (8-13) Biological activity Acetyl neurotensin (8-13) is the shortest analog of neurotensin with full binding and pharmacological activities. CAS Number 74853-69-3 Sequence Sequence Arg-Arg-Pro-Tyr-Ile-Leu Sequence Shortening Sequence Shortening RRPYIL Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Urotensin II, mouse acetate Biological activity Urotensin II, mouse acetate is an endogenous ligand for the orphan G-protein-coupled receptor GPR14 or SENR. Urotensin II, mouse acetate is a potent vasoconstrictor. Urotensin II, mouse acetate plays a physiological role in the central nervous system. Molecular Weight 1692.89 Formula Formula C78H103N18O21S2 Appearance Solid Color White…
Product Name AtPep3 TFA Biological activity AtPep3 TFA is a hormone-like peptide. AtPep3 TFA can enhance salinity tolerance of plants and inhibits the salt-induced bleaching of chlorophyll in seedlings. Formula Formula C102H178N36O32.xC2HF3O2 Sequence Shortening Sequence Shortening EIKARGKNKTKPTPSSGKGGKHN Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name ORG-2766 Biological activity ORG-2766 is an adrenocorticotropic hormone ACTH 4-9 analog and neurotrophic peptide. ORG-2766 affects behavioral processes such as memory and attention in animals, improving symptoms in rats with experimental allergic neuritis. ORG-2766 has a neuroprotective effect. CAS Number 50913-82-1 Sequence Sequence {Met(O2)}-Glu-His-Phe-{d-Lys}-Phe Sequence Shortening Sequence Shortening {Met(O2)}-EHF-{d-Lys}-F Storage Please store the…
Product Name Boc-YPGFL(O-tBu) Biological activity Boc-YPGFL(O-tBu) is a selective δ opioid receptor (DOR) peptide antagonist. CAS Number 179124-36-8 Sequence Sequence Boc-Tyr-Pro-Gly-Phe-Leu-{Thr(OtBu)} Sequence Shortening Sequence Shortening Boc-YPGFL-{Thr(OtBu)} Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Secretin (5-27) (porcine) Biological activity Secretin (5-27) (porcine) (SQ 19301) is an inhibitor of the secretin receptor and also a high-affinity ligand for the vasoactive intestinal peptide (VIP) binding site. Secretin (5-27) (porcine) blocks the secretin-mediated activation of the receptor-coupled cyclic adenosine monophosphate generation system. Secretin (5-27) (porcine) is applicable to studies on…
Product Name Neuropeptide S (human)-13C2,15N Biological activity Neuropeptide S (human)-13C2,15N is the 13C- and 15N-labeled Neuropeptide S (human) (HY-P1389). Neuropeptide S human, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human can be used for Alzheimer’s disease (AD) research. Molecular Weight 2190.46 Formula Formula C9113C2H155N3015NO28S Sequence Sequence Ser-Phe-Arg-Asn-{Gly-13C2,15N}-Val-Gly-Thr-Gly-Met-Lys-Lys-Thr-Ser-Phe-Gln-Arg-Ala-Lys-Ser Sequence Shortening…
Product Name ACTH (6-24) (human) Biological activity ACTH (6-24) (human) (Adrenocorticotropic hormone (6-24)) is an ACTH fragment. ACTH (6-24) (human) is a competitive inhibitor of steroidogenesis induced by ACTH (1-39) and ACTH (5-24) (Kd:13.4 and 3.4 nM). ACTH (6-24) (human) inhibits corticosterone production and cAMP accumulation induced by hPTH 1-34. CAS Number 33512-65-1 Sequence Sequence…
Product Name Leucopyrokinin Biological activity Leucopyrokinin is a myotropic neuropeptide, which accelerates pupariation via central innervation, promotes tanning age dependently. Leucopyrokinin shapes the puparium by contracting and shrinking the integument. CAS Number 104052-00-8 Sequence Sequence {pGlu}-Thr-Ser-Phe-Thr-Pro-Arg-Leu-NH2 Sequence Shortening Sequence Shortening {pGlu}-TSFTPRL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
