Insert HTML here
Showing 369–384 of 883 results
Product Name CLE25 Peptide Biological activity CLE25 peptide moves from the roots to the leaves and modulates NCED3 expression in leaves in association with the receptor-like kinases BAM1 and BAM3. CLE25 peptide induces stomatal closure by modulating abscisic acid accumulation and thereby enhances resistance to dehydration stress. CAS Number 911319-15-8 Sequence Sequence Arg-Lys-Val-Pro-Asn-Gly-Pro-Asp-Pro-Ile-His-Asn Sequence Shortening…
Product Name SNF 9007 Biological activity SNF 9007 is a cholecystokinin analog. SNF 9007 induces analgesia by acting on δ-1, δ-2, and ?? opioid receptors in the mouse brain. Formula Formula C55H66N10O13 CAS Number 137415-20-4 Sequence Sequence Asp-Tyr-{d-Phe}-Gly-Trp-{Me-Nle}-Asp-Phe-NH2 Sequence Shortening Sequence Shortening DY-{d-Phe}-GW-{Me-Nle}-DF-NH2 Storage Please store the product under the recommended conditions in the Certificate…
Product Name Glucagon-like peptide 1 (1-37), human TFA Biological activity Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor. Molecular Weight 4169.48 (free acid) Formula Formula C186H275N51O59.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening Sequence Shortening HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Product Name Small cardioactive peptide A Biological activity Small cardioactive peptide A (SCPA) is a neuropeptide that can be obtained from Aplysia. CAS Number 98035-79-1 Sequence Shortening Sequence Shortening ARPGYLAFPRM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name LH-RH II (chicken) Biological activity LH-RH II (chicken) is one of the two forms of luteinizing hormone-releasing hormone (LHRH) the hypothalamus of the domestic hen, which are structural variants of mammalian LHRH. LH-RH II (chicken) enhances gonadotrophin release in the domestic chicken. Molecular Weight 1236.3 Formula Formula C60H69N17O13 CAS Number 91097-16-4 Sequence Shortening…
Product Name Endokinin C Biological activity Endokinin C is a peptide component of endokinin. Endokinin C works as a neurotransmitter or modulator in the pain system. Pretreatment with endokinin C prevents induction of scratching behavior and thermal hyperalgesia of endokinin A/B in mice. CAS Number 347837-74-5 Sequence Shortening Sequence Shortening KKAYQLEHTFQGLL Storage Please store the…
Product Name Neurokinin B Biological activity Neurokinin B is a tachykinin family peptide that preferentially binds to and activates NK3R over other tachykinin receptors. Neurokinin B preferentially binds to the substance P receptor (SP-N receptor) and mediates acetylcholine release from cholinergic neurons. Neurokinin B regulates the pulsatile release of Kisspeptin and GnRH, stimulates or inhibits…
Product Name Kisspeptin-54(human) Biological activity Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) inhibits tumor metastasis and stimulates the secretion of gonadotropin (LH) and testosterone. Molecular Weight 5857.43 Formula Formula C258H401N79O78 CAS Number…
Product Name Lysipressin Biological activity Lysipressin (Lysine vasopressin ; -Vasopressin ) is a neurohypophyseal nonapeptide with dual cardiovascular regulatory activities of peripheral pressor action and central hypotensive action, and it also regulates pain perception in the body. Lysipressin is an Oxytocin Receptor agonist, with a Ki value of 10.2 nM for porcine OT receptor. Lysipressin…
Product Name Dendroaspis Natriuretic Peptide Biological activity Dendroaspis Natriuretic Peptide is a vasodilator peptide that can be isolated from animal venom. CAS Number 255721-52-9 Appearance Solid Color White to light yellow Sequence Sequence Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala (Disulfide bridge: Cys7-Cys23) Sequence Shortening Sequence Shortening EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA (Disulfide bridge: Cys7-Cys23) Storage Sealed storage, away from moisture Powder -80??C 2 years…
Product Name WWamide-2 Biological activity WWamide-2 is a neuropeptide, which can be isolated form Achatina fulica. WWamide-2 inhibits the rhythmic contraction of anterior byssus retractor muscle (ABRM). CAS Number 149636-88-4 Sequence Sequence Trp-Arg-Glu-Met-Ser-Val-Trp-NH2 Sequence Shortening Sequence Shortening WREMSVW-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Pancreastatin (swine) Biological activity Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas. CAS Number 106477-83-2 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year…
Product Name pTH (39-84) (human) Biological activity pTH (39-84) (human) is the C-terminal fragment of parathyroid hormone (PTH). pTH (39-84) (human) increases Apoptosis. pTH (39-84) (human) can stimulate osteoclast formation. Formula Formula C211H357N67O72 CAS Number 90880-43-6 Appearance Solid Color White to off-white Sequence Sequence Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln Sequence Shortening Sequence Shortening APLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Storage Sealed storage, away from…
Product Name Osteostatin Biological activity Osteostatin, a fragment of parathyroid hormone-related protein (PTHrP) 107-111, promotes bone repair in animal models of bone defects and prevents bone erosion in inflammatory arthritis, inhibits collagen-induced arthritis and inhibits osteoclastic bone resorption directly. Osteostatin can be used for inflammation and immunology research. Molecular Weight 619.67 Formula Formula C27H41N9O8 CAS…
Product Name Cerebellin Biological activity Cerebellin is a neuromodulatory hexadecapeptide that serves as a marker for Purkinje cell maturation. Cerebellin stimulates norepinephrine release via the adenylate cyclase/PKA-dependent signaling pathway. Cerebellin reduces insulin secretion from pancreatic islets under high-glucose conditions. Cerebellin also regulates synaptic structure formation and controls catecholamine secretion in peripheral tissues. Cerebellin can be…
Product Name Secretoneurin, rat Biological activity Secretoneurin, rat is a 33-amino acid neuropeptide produced by proteolytic processing of chromogranin II, widely distributed in the central and peripheral nervous systems, and its release is calcium-dependent. Secretoneurin, rat modulates the activities of caspase-3, caspase-1, the NLRP3 inflammasome, IGF-1R, VEGFR1, VEGFR2, FGFR3, AMPK, ERK1/2/MAPK, and Jak2/Stat3 pathways. Secretoneurin,…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us