Neuropeptides

Product Name IGF-I (24-41) TFA Biological activity IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) TFA is amino acids 24 to 41 fragment of IGF-I. IGF-I TFA, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I TFA is partly responsible for systemic growth hormone (GH) activities. IGF-I TFA has…

Product Name Atrial natriuretic peptide (3-28) (human) Biological activity Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis. CAS Number 102686-43-1 Appearance Solid Color White…

Product Name Prolactin-Releasing Peptide (1-31) (rat) Biological activity Prolactin-Releasing Peptide (1-31) (rat) is a UHR-1/GRP10 receptor ligand. Prolactin-Releasing Peptide (1-31) (rat) reduces fasting-induced food intake, increases plasma levels of LH, FSH, and testosterone in rats. CAS Number 215510-06-8 Sequence Sequence Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Sequence Shortening Sequence Shortening SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 Storage Please store the product under the recommended conditions…

Product Name (Des-Ala3)-GHRP-2 Biological activity (Des-Ala3)-GHRP-2 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 290312-22-0 Appearance Solid…

Product Name GHRF, ovine Biological activity GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH). Formula Formula C221H368N72O66S CAS Number 94948-82-0 Sequence Shortening Sequence Shortening YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 Storage Please store the product under the recommended conditions in the Certificate of…

Product Name ACTH (7-38) (human) Biological activity ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity. CAS Number 68563-24-6 Appearance Solid Color White to off-white Sequence Sequence Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu Sequence Shortening…

Product Name Acetyl-ACTH (7-24) (human, bovine, rat) Biological activity Acetyl-ACTH (7-24) (human, bovine, rat) causes a marked decrease of ACTH-evoked corticosterone and aldosterone release. CAS Number 1815618-01-9 Sequence Sequence Ac-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening Ac-FRWGKPVGKKRRPVKVYP Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Kisspeptin-54 (27-54) (human) Biological activity Kisspeptin-54 (27-54) (human) is a polypeptide that can be used for compound synthesis and pharmaceutical research. CAS Number 1135442-77-1 Sequence Sequence Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 Sequence Shortening Sequence Shortening IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.