Product Name Adrenocorticotropic Hormone (ACTH) (18-39), human Biological activity Adrenocorticotropic Hormone (ACTH) (18-39), human is a corticotropinlike intermediate lobe peptide, which is produced in the melanotrophs of the intermediate lobe of the pituitary. Formula Formula C112H165N27O36 CAS Number 53917-42-3 Sequence Sequence Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening RPVKVYPNGAEDESAEAFPLEF Storage Please store the product under the recommended…
Product Name D-JBD19 Biological activity D-JBD19 is an impermeable peptide that serves as an inactive control for the JNK inhibitor D-JNKI1 (HY-P0069). D-JNKI1 has neuroprotective effects. Molecular Weight 2250.56 Formula Formula C99H164N32O28 CAS Number 954134-42-0 Appearance Solid Color White to off-white Sequence Sequence Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg Sequence Shortening Sequence Shortening DQSRPVQPFLNLTTPRKPR
Product Name Glucagon (1-29), bovine, human hydrochloride Biological activity Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis. Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation. Molecular Weight 3519.21 Formula Formula C153H226ClN43O49S CAS Number 28270-04-4 Appearance Solid Color White to off-white Sequence…
Product Name Retrobradykinin Biological activity Retrobradykinin has the reverse sequence of Bradykinin (HY-P0206). Retrobradykinin exhibits no kinin activity and can be used as a negative control for Bradykinin. CAS Number 5991-13-9 Sequence Sequence Arg-Phe-Pro-Ser-Phe-Gly-Pro-Pro-Arg Sequence Shortening Sequence Shortening RFPSFGPPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Spexin Biological activity Spexin (Neuropeptide Q) is a selective agonist of galanin receptors GAL2 and GAL3, and is a conserved peptide that functions as a neurotransmitter/neuromodulator and endocrine factor. Spexin can function through both central and peripheral actions. Spexin upregulates Beclin 1 to inhibit ferroptosis induced by excessive autophagy, reduces the uptake of…
Product Name 5-Valine-angiotensin I Biological activity 5-Valine-angiotensin I is an Ang I peptide belonging to angiotensin I. 5-Valine-angiotensin I induces muscle contraction, can be used for renin-angiotensin system studies. Angiotensin I is a putative neurotransmitter, is the precursor of angiotensin II and of angiotensin fragment 1-7, which are involved in regulation of fluid volume and…
Product Name Neuromedin U-25 (porcine) Biological activity Neuromedin U-25 (porcine) is a uterus stimulating and hypertensive peptides. CAS Number 98395-76-7 Appearance Solid Color White to off-white Sequence Sequence Phe-Lys-Val-Asp-Glu-Glu-Phe-Gln-Gly-Pro-Ile-Val-Ser-Gln-Asn-Arg-Arg-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 Sequence Shortening Sequence Shortening FKVDEEFQGPIVSQNRRYFLFRPRN-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1…
Product Name Pheromonotropin (pseudaletia separata) Biological activity Pheromonotropin (Pseudaletia separata) (Pss-PT) is an armyworm (Pseudaletia separata) pheromone with the C-terminal pentapeptide FXPRL-amide. Pheromonotropin (Pseudaletia separata) belongs to the PK/PBAN family and stimulates sex pheromone biosynthesis in moths, mediating feeding (intestinal muscle contraction), development (embryonic diapause, pupal diapause, and pupation), and defense against natural enemy insects…
Product Name [Sar1, Ile8]-Angiotensin II TFA Biological activity -Angiotensin II (TFA) is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels. Formula Formula C48H74F3N13O12 CAS Number 2918768-31-5 Appearance Solid Color White to off-white Sequence Sequence {SAR}-Arg-Val-Tyr-Ile-His-Pro-Ile Sequence Shortening Sequence…
Product Name Gastrin I (1-14), human TFA Biological activity Gastrin I (1-14), human TFA is 1-14 fragment of human gastrin I peptide. Gastrin I is an endogenous, gastrointestinal peptide hormone. Gastrin is the major hormonal regulator of gastric acid secretion. Appearance Solid Color White to off-white Sequence Sequence {Glp}-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp Sequence Shortening Sequence Shortening {Glp}-GPWLEEEEEAYGW Storage…
Product Name Big Endothelin-2 (human) Biological activity Big Endothelin-2 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Neuropeptide AF1 Biological activity Neuropeptide AF1 is a FMRFamide-like neuropeptide. Neuropeptide AF1 can be isolated from head extracts of the nematode Ascaris suum. Neuropeptide AF1 rapidly and reversibly abolishs slow membrane potential oscillations of identified ventral and dorsal inhibitory motoneurons and selectively reduces their input resistances. Neuropeptide AF1 inhibits locomotory movements in intact…
Product Name CART(55-102)(human) Biological activity CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y. CAS Number 214050-22-3 Appearance Solid Color White to off-white Sequence Sequence Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Sealed storage, away from moisture and light, under nitrogen…
Product Name GLP-1 (1-36) amide (human, rat) Biological activity GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells. CAS Number 99658-04-5 Appearance Solid Color White to…
Product Name Calcitonin gene-related peptide free acid Biological activity Calcitonin gene-related peptide (CGRP) free acid is a 37-amino acid neuropeptide, which represents the deamidated form of α-CGRP (human) (HY-P1071). Calcitonin gene-related peptide free acid is produced in the central and peripheral nervous systems of rats, and localizes to specific sensory, integrative and motor neuron systems,…
Product Name Biotin-Neurokinin A Biological activity Biotin-Neurokinin A is a biotinylated Neurokinin A (HY-P0197). Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues. Appearance Solid Color White to off-white Sequence Sequence {Biotin}-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Sequence Shortening Sequence…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
