Acetyl Gastric Inhibitory Peptide (human) TFA

Description

Product Name	ACTH (7-38) (human)
Biological activity	ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity.
CAS Number	68563-24-6
Appearance	Solid
Color	White to off-white
Sequence	Sequence Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu
Sequence Shortening	Sequence Shortening FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Storage	Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture)