Insert HTML here
Showing 113–128 of 883 results
![[Pro3]-GIP (Rat)](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides5-300x300.jpg)
Product Name Canine KP-10 Biological activity Canine KP-10 is a potent kisspeptin that elicits strong gonadotropin and estradiol responses in female dogs in estrus. Sequence Sequence Tyr-Asn-Trp-Asn-Val-Phe-Gly-Leu-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YNWNVFGLRY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name YNPCVMYL (Thioester: Cys4-Leu8) Biological activity YNPCVMYL (Thioester: Cys4-Leu8) is a polypeptide chain of the YNPCVMYL sequence. The link between the fourth and eighth amino acids in the sequence has the properties of a thioester, which is formed between cysteine (Cys4) and leucine (Leu8). Sequence Sequence Tyr-Asn-Pro-Cys-Val-Met-Tyr-Leu (Thioester: Cys4-Leu8) Sequence Shortening Sequence Shortening YNPCVMYL…
Product Name CART(55-102)(rat) Biological activity CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior. CAS Number 209615-79-2 Appearance Solid Color White to off-white Sequence Sequence Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Sequence Shortening Sequence Shortening IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47) Storage Sealed storage,…
Product Name Adrenotensin (human) Biological activity Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones. Formula Formula C143H224N42O43 CAS Number 166546-72-1 Sequence Sequence Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu Sequence Shortening Sequence Shortening SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL Storage Please store the…
Product Name [Leu13]-Motilin Biological activity -Motilin (KW-5139) is a motilin analogue. -Motilin stimulates gastrointestinal motility in the rabbit. -Motilin causes concentration-dependent contractions of the gastric antrum, duodenum, jejunum, ileum and the descending colon in vitro. CAS Number 59530-69-7 Sequence Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Leu-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln Sequence Shortening Sequence Shortening FVPIFTYGELQRLQEKERNKGQ Storage Please store the product under the recommended conditions…
Product Name Proinsulin C-Peptide (31-63), porcine Biological activity Proinsulin C-Peptide (31-63), porcine is a peptide fragment of the cleavage product porcine proinsulin. CAS Number 28152-90-1 Sequence Shortening Sequence Shortening RREAENPQAGAVELGGGLGGLQALALEGPPQKR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Angiotensin I/II (4-8) Biological activity Angiotensin I/II (4-8), a major metabolite of Angiotensin II, is a C-terminal 4-8 pentapeptide. CAS Number 52530-60-6 Sequence Shortening Sequence Shortening YIHPF Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) Biological activity (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) is the reaction product with gadolinium tetraazacyclododecanetriacetate derivative. (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) involves in preparation of tetraazacyclododecane macrocycle metal complexes for production of conjugates with biomolecules and for…
Product Name Gastric Inhibitory Polypeptide (1-30), porcine Biological activity Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin. CAS Number 134875-67-5 Sequence Shortening Sequence Shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQK Storage Please store the product under the recommended conditions…
Product Name Thymus Factor Biological activity Thymus Factor (Thymulin) is a key factor responsible for the maturation of humoral immunological faculty. Thymulin is an inhibitor of ERK. CAS Number 62036-77-5 Sequence Shortening Sequence Shortening QAKSQGGSN Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name PEN (rat) Biological activity PEN (rat), one of the most abundant hypothalamic neuropeptide and derived from the proprotein ProSAAS, is an endogenous ligand of GPR83. Formula Formula C102H169N27O33 CAS Number 569364-13-2 Appearance Solid Color White to off-white Sequence Sequence Ala-Val-Asp-Gln-Asp-Leu-Gly-Pro-Glu-Val-Pro-Pro-Glu-Asn-Val-Leu-Gly-Ala-Leu-Leu-Arg-Val Sequence Shortening Sequence Shortening AVDQDLGPEVPPENVLGALLRV Storage Sealed storage, away from moisture Powder -80??C…
Product Name Tyr-Somatostatin-28 Biological activity Tyr-Somatostatin-28 is a somatostatin that adds a Tyrosine amino acid to Somatostatin-28. Formula Formula C146H216N42O41S3 CAS Number 86649-84-5 Sequence Shortening Sequence Shortening YSANSNPAMAPRERKAGCKNFFWKTFTSC (disulfide bridge:Cys18-Cys29) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Sar4] Substance P (4-11) Biological activity Substance P (4-11) is an analog of Substance P (4-11). Substance P (4-11), the C-terminus fragment of Substance P (HY-P0201), is a Substance P agonist. Sequence Shortening Sequence Shortening {Sar}-QQFFGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name β-Bag cell peptide Biological activity β-Bag cell peptide is a neuroactive peptide. β-Bag cell peptide elevates cyclic AMP levels in the bag cell neurons. β-Bag cell peptide decreases the amplitudes of the voltage-dependent potassium currents. Formula Formula C33H53N13O6 CAS Number 109024-47-7 Sequence Shortening Sequence Shortening RLRFH Storage Please store the product under the…
Product Name γ-Neuropeptide (rabbit) Biological activity γ-Neuropeptide (rabbit) can be isolated from rabbit intestine. γ-Neuropeptide is an endogenous neurokinin peptide that acts as a neurokinin 2 (NK2) receptor agonist. γ-Neuropeptide mediates hypothalamic-pituitary-adrenal (HPA) axis, as well as reproductive hormone release. Molecular Weight 2320.59 Formula Formula C99H158N34O29S CAS Number 114882-65-4 Appearance Solid Color White to off-white…
Product Name Biotin-Substance P Biological activity Biotin-Substance P is the biotin tagged Substance P. Substance P (Neurokinin P) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R). Molecular Weight 1574.9 Formula Formula C73H112N20O15S2 CAS Number 87468-58-4 Appearance Solid…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us