5-FAM-Ahx-LL-37 TFA
Description
5-FAM-Ahx-LL-37 TFA is LL-37, human (HY-P1222) labeled with 5-FAM (HY-66022). The carboxyfluorescein group is linked via 6-aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue amphipathic antimicrobial peptide derived from cathelicidin with broad-spectrum antibacterial activity.
Product Details
| Product Name | 5-FAM-Ahx-LL-37 TFA |
| Biological activity | 5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via a 6-carbon spacer, 6-Aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. |
| Color | Light yellow to yellow |
| Sequence | {5-FAM-Ahx}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | {5-FAM-Ahx}[LL-37, 37 aa] |
| Storage | Sealed storage, away from moisture |
