5-FAM-LL-37 TFA
Description
5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). It is a fluorescein-labeled LL-37 peptide that retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to bacterial cell membranes, disrupts membrane integrity, and exhibits broad-spectrum antibacterial activity.
Product Details
| Product Name | 5-FAM-LL-37 TFA |
| Biological activity | 5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). 5-FAM-LL-37 TFA is a LL-37 peptide labeled with fluorescein, which retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to the bacterial cell membrane, destroys the integrity of the membrane, and exhibits board-spectrum antibacterial efficacy. |
| Color | Light yellow to yellow |
| Sequence | {Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | {Fluorescein-5-carbonyl}-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Storage | Sealed storage, away from moisture |
