??-defesin 1 (pig) TFA
Description
??-defensin 1 (pig) (pBD-1) TFA is an endogenous, constitutively expressed antimicrobial peptide (AMP) derived from porcine tissues, particularly expressed at porcine mucosal epithelial sites. ??-defensin 1 (pig) TFA has antibacterial effects and contributes to porcine mucosal and systemic host defense.
Product Details
| Product Name | ??-defesin 1 (pig) TFA |
| Biological activity | ??-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. ??-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs. |
| Formula | C180H313N59O50S9.10C2HF3O2 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Met-Arg-Leu-His-Arg-Leu-Leu-Leu-Val-Phe-Leu-Leu-Met-Val-Leu-Leu-Pro-Val-Pro-Gly-Leu-Leu-Lys-Asn-Ile-Gly-Asn-Ser-Val-Ser-Cys-Leu-Arg-Asn-Lys-Gly-Val-Cys-Met-Pro-Gly-Lys-Cys-Ala-Pro-Lys-Met-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Met-Pro-Gln-Val-Lys-Cys-Cys-Lys-Arg-Lys |
| Sequence Shortening | NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6?? |
| Storage | Sealed storage, away from moisture and light |
