Glucagon-like peptide 1 (1-37), human
Description
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
Product Information
| Product Name | Glucagon-like peptide 1 (1-37), human |
| Molecular Weight | 4169.48 |
| Formula | C186H275N51O59 |
| CAS Number | 87805-34-3 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Sequence Shortening | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture) ???? & ??Ʒ???? ???ȣ? 99.32% ѡ?????Σ? HY-P1145-91**** Data Sheet (520 KB) SDS (394 KB) COA (276 KB)LCMS (98 KB)Ԫ?ط??????? (223 KB) ??Ʒʹ??ָ?? (1538 KB) ?ο????? . Zhao L, et al. Glucagon-like peptide-1(1-37) can enhance blood glucose homeostasis in mice. Regul Pept. 2012 Oct 10;178(1-3):1-5. ? |
