Product Name Leucomyosuppressin Biological activity Leucomyosuppressin, an insect neuropeptide, is an inhibitory myotropic peptide. Leucomyosuppressin inhibits evoked transmitter release at the mealworm neuromuscular junction. CAS Number 106884-19-9 Sequence Sequence {Glp}-Asp-Val-Asp-His-Val-Phe-Leu-Arg-Phe-NH2 Sequence Shortening Sequence Shortening {Glp}-DVDHVFLRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
C-VGB3 is a selective vascular endothelial growth factor receptor 2 (VEGFR2) antagonist, which inhibits VEGFR2-mediated PI3K/AKT/mTOR and PLCγ/ERK1/2 signaling pathways. C-VGB3 binds to the extracellular domain of VEGFR2, blocking ligand-receptor interaction and inducing apoptosis in endothelial and tumor cells through both intrinsic (involving Bcl2 family and caspases) and extrinsic (death receptor-mediated) pathways. C-VGB3 is promising…
c(R3W4V) is an antimicrobial peptide. c(R3W4V) has a relatively stable transmembrane structure. c(R3W4V) has IC50 values of 0.27, 0.46, and 0.05 ??M against E. coli, S. aureus, and B. subtilis, respectively. Product Details Product Name c(R3W4V) Biological activity c(R3W4V) is an antimicrobial peptide. c(R3W4V) has a relatively stable transmembrane structure. c(R3W4V) has IC50 values of…
c[Arg-Arg-Arg-Arg-Dip-Dip-Dip] (Compound 8C) has broad-spectrum activity against drug-resistant Gram-positive and Gram-negative bacteria, with MICs of 3.1, 3.1, 12.5, and 12.5 ??g/mL against MRSA (ATCC BAA-1556), S. aureus (ATCC 29213), P. aeruginosa (ATCC 27883), and E. coli (ATCC 25922), respectively. Product Details Product Name c[Arg-Arg-Arg-Arg-Dip-Dip-Dip] Biological activity c (Compound 8C) shows broad-spectrum activity against drug-resistant Gram-positive…
c[Arg-Arg-Arg-Arg-Nal-Nal-Nal] (Compound 9C) has broad-spectrum activity against drug-resistant Gram-positive and Gram-negative bacteria, with MICs of 3.1, 3.1, 12.5, and 25 ??g/mL against MRSA (ATCC BAA-1556), S. aureus (ATCC 29213), P. aeruginosa (ATCC 27883), and E. coli (ATCC 25922), respectively. Product Details Product Name c[Arg-Arg-Arg-Arg-Nal-Nal-Nal] Biological activity c (Compound 9C) shows broad-spectrum activity against drug-resistant Gram-positive…
C16G2 is a specifically targeted antimicrobial peptide (STAMP) that targets the cariogenic oral pathogen Streptococcus mutans. C16G2 achieves bacterial killing by specifically recognizing and disrupting the bacterial cell membrane, leading to leakage of small molecules and loss of membrane potential. Unlike broad-spectrum antimicrobial peptides, C16G2 has higher selectivity and efficacy against Streptococcus mutans. Product Details…
C16G2 TFA is a specifically targeted antimicrobial peptide (STAMP) that targets the cariogenic oral pathogen Streptococcus mutans. C16G2 TFA achieves bacterial killing by specifically recognizing and disrupting the bacterial cell membrane, leading to leakage of small molecules and loss of membrane potential. Unlike broad-spectrum antimicrobial peptides, C16G2 TFA has higher selectivity and efficacy against Streptococcus…
C18G is a biologically active peptide (C18G is a synthetic ??-helical peptide derived from human platelet factor IV. This peptide has been found to have antibacterial effects and activity against Salmonella). Product Details Product Name C18G Biological activity C18G is a biological active peptide. (C18G is a synthetic ??-helical peptide derived from human platelet factor…
Product Name C3bot(154-182) TFA Biological activity C3bot(154-182) TFA is a C3 peptide enhances recovery from spinal cord injury by improving regenerative growth of descending fiber tracts. C3bot(154-182) TFA represents a promising tool to foster axonal protection and/or repair, as well as functional recovery after traumatic CNS injury. Formula Formula C139H222F3N37O42S Sequence Shortening Sequence Shortening VAKGSKAGYIDPISAFAGQLEMLLPRHST…
Product Name Xenin-8 Biological activity Xenin-8 is the C-terminal octapeptide fragment of xenin, which belongs to the xenopsin family of peptides. Xenin-8 stimulates basal insulin secretion, dose-dependently enhances glucose (EC50 = 0.16 nM) and arginine-induced insulin release, and enhances arginine- and Carbamoylcholine chloride (HY-B1208)-induced glucagon secretion. Xenin-8 antagonizes the inhibition of glucagon release by elevated…
C5A is a microbicidal peptide and an anti-hepatitis C virus (HCV) and anti-HIV compound. C5A disrupts the membrane integrity of HIV virions and the integrity of the conical capsid core surrounding the viral genome. C5A inhibits the in vitro infectivity of various primary HIV isolates in various primary target cells. C5A protects mice from vaginal…
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Other Purity: >90% (HPLC-MS) Quantification: No Sequence: H-MHTAPGWGYRLS-OH Specifications: 12mer cancer peptide
Caerin 1.1 TFA is a host defense peptide that can be isolated from the glandular secretions of the Australian tree frog Litoria. Caerin 1.1 TFA inhibits HeLa cell proliferation and mediates apoptosis. Caerin 1.1 TFA may enhance adaptive T cell immune responses. Product Details Product Name Caerin 1.1 TFA Biological activity Caerin 1.1 TFA is…
Caerulein is a decapeptide and a potent cholecystokinin receptor agonist. Caerulein is a safe and effective cholecystokinetic agent with a direct spasmogenic effect on the gallbladder muscle and bile ducts. Product Information Product Name Caerulein Molecular Weight 1352.41 Formula C58H73N13O21S2 CAS Number 17650-98-5 Appearance Solid Color White to off-white Sequence {pGlu}-Gln-Asp-Tyr(SO3H)-Thr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening {pGlu}-QD-Y(SO3H)-TGWMDF-NH2 Storage…
Product Name Urechistachykinin II Biological activity Urechistachykinin II (Uru-TK II), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect. CAS Number 149097-04-1 Sequence Sequence Ala-Ala-Gly-Met-Gly-Phe-Phe-Gly-Ala-Arg-NH2 Sequence Shortening Sequence Shortening AAGMGFFGAR-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name GLP-1(9-36)amide TFA Biological activity GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor. Appearance Solid Color White to off-white Sequence Sequence Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Storage Sealed storage, away from moisture…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
![c[Arg-Arg-Arg-Arg-Dip-Dip-Dip]](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides4-300x300.jpg)
