Insert HTML here
Showing 321–336 of 3705 results
AMG133 peptide payload is a GLP-1 analog agonist peptide. AMG133 peptide potently activates GLP-1R, and exhibits weight loss and metabolic improvement activities. AMG133 peptide payload can be used for the synthesis of AMG 133 (HY-164535). Product Information Product Name AMG133 peptide payload Molecular Weight 4600.70 Formula C196H290BrN55O69 CAS Number 3137854-22-6 Appearance Solid Color White to…
AMG133 peptide payload TFA is a GLP-1 analog agonist peptide. AMG133 peptide payload TFA potently activates GLP-1R and exhibits weight loss and metabolic improvement activities. AMG133 peptide payload TFA can be used for the synthesis of AMG 133 (HY-164535). Product Information Product Name AMG133 peptide payload TFA Molecular Weight 4600.70 (free base) Formula C196H290BrN55O69.xC2HF3O2 Appearance…
Aminocandin (HMR 3270) is water-soluble antifungal agent of the echinocandin class with excellent activity against Aspergillus and Candida spp.. Product Information Product Name Aminocandin Molecular Weight 1102.28 Formula C56H79N9O14 CAS Number 227472-48-2
Aminocandin (HMR 3270) is a water-soluble echinocandin antifungal agent with good activity against Aspergillus and Candida spp. Product Details Product Name Aminocandin Biological activity Aminocandin (HMR 3270) is water-soluble antifungal agent of the echinocandin class with excellent activity against Aspergillus and Candida spp.. Molecular Weight 1102.28 Formula C56H79N9O14 CAS Number 227472-48-2 Storage Please store the…
Amp1EP9 is an antimicrobial peptide. Amp1EP9 is a powerful tool for developing effective and non-toxic antibacterial active molecules. Amp1EP9 has potential for research on multidrug-resistant bacterial infections. Product Details Product Name Amp1EP9 Biological activity Amp1EP9 is an antimicrobial peptide. Amp1EP9 is a powerful tool for developing potent and nontoxic antimicrobial agents. Amp1EP9 has the potential…
Amphomycin is a lipopeptide antibiotic that inhibits peptidoglycan synthesis and blocks cell wall development. Amphomycin exhibits potent antibacterial activity against methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant Enterococci (VRE), penicillin-gentamicin-erythromycin-resistant Streptococcus pneumoniae, and linezolid-quinupristin-dalfopristin-resistant Enterococci. Product Details Product Name Amphomycin Biological activity Amphomycin is a lipopeptide antibiotic that inhibits peptidoglycan synthesis and blocks cell wall development. Amphomycin…
AMPR-22 is an antimicrobial peptide. AMPR-22 can bind to bacterial membranes and induce membrane permeabilization. AMPR-22 is effective against a mouse model of sepsis induced by MDR strains. Product Details Product Name AMPR-22 Biological activity AMPR-22 is an antimicrobial peptide. AMPR-22 can bind to the bacterial membrane and induces membrane permeabilization. AMPR-22 is effective against…
Product Name biotin-Bradykinin Biological activity biotin-Bradykinin is a biological active peptide. (Biotin labeled HY-P0206) CAS Number 477319-71-4 Appearance Solid Color White to off-white Sequence Sequence {Biotin-Arg}-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg Sequence Shortening Sequence Shortening {Biotin-Arg}-PPGFSPFR Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage,…
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, Disulfide
Product Name Lys-Conopressin-G Biological activity Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis). CAS Number 111317-91-0 Sequence Sequence Cys-Phe-Ile-Arg-Asn-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys1-Cys6) Sequence Shortening Sequence Shortening CFIRNCPKG-NH2 (Disulfide bridge: Cys1-Cys6) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Prolactin-Releasing Peptide (1-31), bovine Biological activity Prolactin-Releasing Peptide (1-31), bovine is a fragment of the prolactin releasing peptide (PrRP). Sequence Shortening Sequence Shortening SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name D-JBD19 TFA Biological activity D-JBD19 TFA is a non-permeable peptide. D-JBD19 TFA has neuroprotective effects. Molecular Weight 2364.58 Formula Formula C101H165F3N32O30 Sequence Shortening Sequence Shortening DQSRPVQPFLNLTTPRKPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Somatostatin-28 (1-14) Biological activity Somatostatin-28 (1-14) is an N-terminal fragment of the neuropeptide somatostatin-28. Formula Formula C61H105N23O21S CAS Number 79243-10-0 Appearance Solid Color White to off-white Sequence Sequence Ser-Ala-Asn-Ser-Asn-Pro-Ala-Met-Ala-Pro-Arg-Glu-Arg-Lys Sequence Shortening Sequence Shortening SANSNPAMAPRERK Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Product Name Neuropeptide EI, rat Biological activity Neuropeptide EI, rat displays functional melanin concentrating hormone (MCH)-antagonist and melanocyte-stimulating hormone (MSH) agonist activity in different behavioral paradigms. CAS Number 125934-45-4 Sequence Sequence Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-NH2 Sequence Shortening Sequence Shortening EIGDEENSAKFPI-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Tyr11]-Somatostatin Biological activity -Somatostatin is a neuroavtive peptide for proteomics research. Somatostatin is one of many neuroactive substances that influence retinal physiology. Formula Formula C76H104N18O20S2 CAS Number 59481-27-5 Appearance Solid Color White to off-white Sequence Sequence Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Tyr-Thr-Ser-Cys (Disulfide bridge:Cys3-Cys14) Sequence Shortening Sequence Shortening AGCKNFFWKTYTSC (Disulfide bridge:Cys3-Cys14) Storage Sealed storage, away from moisture Powder…
Product Name Calcitonin (human) Biological activity Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research. Molecular Weight 3417.87 Formula Formula C151H226N40O45S3 CAS Number 21215-62-3 Appearance Solid Color White to off-white Sequence Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7) Sequence Shortening Sequence Shortening…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us