Indolicidin Peptide
Sequence: H-ILPWKWPWWPWRR-NH2 Specifications: Antimicrobial peptide
Showing 369–384 of 638 results


Sequence: H-GILGFVFTL-OH Specifications: 9mer peptide as TFA salt

Sequence: H-RAIGGGLSSVGGGSSTIKY-OH Specifications: Antimicrobial peptide

Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH Specifications: Antimicrobial peptide


Sequence: H-GIGKFLHSAGKFGKAFVGEIMKS-OH Specifications: Antimicrobial peptide

Sequence: H-GIGKFLHSAKKFGKAFVGEIMNS-OH Specifications: Antimicrobial peptide



Sequence: H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH Specifications: Antimicrobial peptide





Sequence: NOTA-G-4Abz-QWAVGHLM-NH2 (4Abz = 4-Amino-Benzoic acid Specifications: NOTA-AMBA

Sequence: H-SIINFEKL-OH Specifications: 8mer peptide as TFA salt
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us