Insert HTML here
Showing 369–384 of 3705 results
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Insect Purity: >95% (HPLC-MS) Quantification: No Sequence: H-GLLKRIKTLL-NH2 Specifications: Antimicrobial peptide
Product Name Helospectin II Biological activity Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum. Molecular Weight 4008.55 Formula Formula C180H288N46O57 CAS Number 93585-83-2 Sequence Sequence…
Anrikefon is a peripherally restricted kappa opioid receptor (KOR) agonist, with an IC50 of 0.54 nM, an EC50 of 2.41 pM, and a Ka of 0.068 nM against human KOR, and it exhibits high selectivity over ?? and δ opioid receptors. Anrikefon exerts analgesic effects by inhibiting behaviors associated with inflammatory, postoperative and neuropathic pain,…
Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Drosophila Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-RQIKIWFQNRRMKWKK-OH
Product Name Helodormin Biological activity Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum). Helodormin affects a variety of cellular functions by modulating intracellular signaling through activation of adenylate cyclase. Helodormin can be used to study the evolution and function of the secretin and VIP peptide families. CAS…
Product Name Stresscopin (human) Biological activity Stresscopin (human) is a selective ligand of type 2 adrenocorticotropin-releasing hormone (CRH) receptors and can be used in the research of stress-related diseases. CAS Number 352020-03-2 Sequence Sequence Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 Sequence Shortening Sequence Shortening TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Antho-Rwamide II Biological activity Antho-Rwamide II is a neuropeptide that can be isolated from the sea anemone Anthopleura elegantissima. Antho-Rwamide II can induce contraction of the endothelial muscles of the sea anemone and participate in neurotransmission. Antho-Rwamide II can be used to explore the function of the nervous system in invertebrates. CAS Number…
Product Name SP1 Biological activity SP1 is an α-peptide encoded by the mating pheromone MFα1 gene in Candida albicans, which can induce cell growth arrest at the mating type locus MTLa in Candida albicans. SP1 can be used in the study of the prevention and treatment of Candida albicans infection. Formula Formula C72H97N17O19 CAS Number…
Antiarrhythmic peptide (cattle atrium), a hexapeptide, shows a protective effect against experimental agent induced arrhythmias. Product Information Product Name Antiarrhythmic peptide (cattle atrium) Molecular Weight 470.48 Formula C19H30N6O8 CAS Number 81771-37-1 Sequence Shortening GP-Hyp-GAG Sequence Shortening GP-Hyp-GAG
Antiflammin-1 is an anti-inflammatory peptide 1 (MQMKKVLDS). Antiflammin-1 is a derivative of uteroglobin. Antiflammin-1 has anti-inflammatory and antifibrotic actions in bleomycin (HY-108345)-induced lung injury. Product Information Product Name Antiflammin-1 Molecular Weight 1079.33 Formula C45H82N12O14S2 CAS Number 118850-71-8 Sequence Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser Sequence Shortening MQMKKVLDS
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Kinase Layout: Freeze-dried in plastic vial Organism: Human Protein Name: BCL 2 Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-WLSLKTLLSL-OH Specifications: 10mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Merkel cell carcinoma, Nephritis, interstitial Layout: Freeze-dried in plastic vial Organism: BK Polyomavirus (BKV) Protein Name: Major capsid protein VP1 Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-AITEVECFL-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Bone marrow stromal antigen 2 Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KLQDASAEV-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Adeno-Associated Virus (AAV) Protein Name: Capsid protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-VPQYGYLTL-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Human Protein Name: CD antigen Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-SLFLGILSV-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Human Protein Name: CD antigen Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-TLKDGIIMI-OH Specifications: 9mer peptide as TFA salt
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us