Biotinoyl-Beta-Amyloid (1-42) HFIP treated
Sequence: Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: N-terminally biotinylated synthetic Beta-Amyloid peptide (1-42)
Showing 289–304 of 638 results
-
-
BMAP-18 Antimicrobial Peptide
Sequence: H-GRFKRFRKKFKKLFKKLS-OH Specifications: Antimicrobial peptide
-
BMAP-27 Peptide
Sequence: H-GRFKRFRKKFKKLFKKLSPVIPLLHLG-OH Specifications: Antimicrobial peptide
-
Braftide, CAS 2411851-64-2
Sequence: H-TRHVNILLFM-NH2 Specifications: 10mer cancer peptide
-
Buforin II Peptide
Sequence: H-TRSSRAGLQFPVGRVHRLLRK-OH Specifications: Antimicrobial peptide
-
-
-
Calcitermin Antimicrobial Peptide
Sequence: H-VAIALKAAHYHTHKE-OH Specifications: Antimicrobial peptide
-
CAMCheck Kit
Sequence: See Product Documentation Specifications: Mixture of equimolar amounts of 3 peptides
-
Cecropin A Peptide
Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Specifications: Antimicrobial peptide
-
CEF Pool (extended)
Sequence: see additional product documentation Specifications: Defined HLA class I-restricted T-cell epitopes
-
CEF Pool (standard)
Sequence: see additional product documentation Specifications: Defined HLA class I-restricted T-cell epitopes
-
CEFSX Ultra SuperStim Pool – Premium Grade
Sequence: see additional product documentation Specifications: Defined HLA restricted T-cell epitopes
-
CEFT MHC-II Pool
Sequence: see additional product documentation Specifications: Defined HLA class II-restricted T-cell epitopes
-
CEFT Pool – Premium Grade
Sequence: see additional product documentation Specifications: Defined HLA class I & II-restricted T-cell epitopes
-
CEFX Ultra SuperStim Pool
Sequence: see additional product documentation Specifications: Defined HLA restricted T-cell epitopes
