Insert HTML here
Showing 289–304 of 3705 results
Product Name Adrenocorticotropic Hormone (ACTH) (4-10), human Biological activity Adrenocorticotropic Hormone (ACTH) (4-10), human is a melanocortin 4 (MC4R) receptor agonist. Molecular Weight 962.09 Formula Formula C44H59N13O10S CAS Number 780533 Appearance Solid Color White to off-white Sequence Sequence Met-Glu-His-Phe-Arg-Trp-Gly Sequence Shortening Sequence Shortening MEHFRWG
Product Name γ3-MSH Biological activity γ3-MSH is derived from the N-terminal segment of pro-opiomelanocortin (POMC). γ3-MSH stimulates aldosterone secretion by human adrenal tumor cells in culture. CAS Number 72629-64-2 Sequence Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln Sequence Shortening Sequence Shortening YVMGHFRWDRFGRRNGSSSSGVGGAAQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Gly11] Substance P Biological activity Substance P is an analog of Substance P (HY-P0201). Substance P is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. Sequence Shortening Sequence Shortening RPKPQQFFGLG-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Gastrin-Releasing Peptide, human Biological activity Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. Formula Formula C130H204N38O31S2 CAS Number 93755-85-2 Appearance Solid Color White to off-white Sequence Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Sequence…
AEC5 is a lipopeptide substance with antifungal activity against Cryptococcus neoformans infection. At the MIC concentration (6.3 ??g/mL) against C. neoformans, AEC5 shows no significant cytotoxicity against human lung, liver, or red blood cells. Product Details Product Name AEC5 Biological activity AEC5 is a Lipopeptoid with antifungal activity against Cryptococcus neoformans. AEC5 has no observable…
Aeschna defensin is an antimicrobial peptide derived from the hemolymph of dragonfly aquatic larvae. Aeschna defensin has strong activity against Gram-positive bacteria. Product Details Product Name Aeschna defensin Biological activity Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria. Sequence Shortening GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR (Disulfide…
Product Name TLQP-30 Biological activity TLQP-30 is a VGF peptide. CAS Number 922704-13-0 Sequence Shortening Sequence Shortening TLQPPASSRRRHFHHALPPARHHPDLEAQA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Parathyroid Hormone (1-34), bovine Biological activity Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis. Molecular Weight 4108.77 Formula Formula C183H288N54O50S2 CAS Number 12583-68-5 Appearance Solid…
Product Name [Glp6] Substance P (6-11) Biological activity Substance P (6-11) is an analogue of substance P (6-11). Substance P (6-11) stimulates -inositol monophosphate (-IP1) formation in rat urinary bladder by acting on the ‘septide-sensitive’ tachykinin receptors. CAS Number 61123-13-5 Sequence Shortening Sequence Shortening Glp-FFGLM-NH2 Storage Please store the product under the recommended conditions in…
ALA-A2 is an anticancer peptide discovered in ??-lactalbumin that selectively kills cancer cells by inducing autophagy. ALA-A2 has cell-penetrating function and can effectively enter cells without relying on membrane-lytic effects. In A549 lung cancer cells, ALA-A2 exhibits significant dose-dependent anticancer activity. ALA-A2 is expected to be used in research in the fields of anticancer therapy…
Alamethicin is a linear 20-amino-acid antibiotic that induces voltage-gated conductance in model and cell membranes. Alamethicin shows antibacterial activity against Gram-positive bacteria but not against Gram-negative bacteria. Alamethicin can form amphipathic ??-helical structures in biofilms. Product Details Product Name Alamethicin Biological activity Alamethicin is a linear 20-amino acid antibiotic, which can induce voltage-gated conductance in…
Alamethicin F 50 is an antibiotic. Alamethicin F 50 consists of membrane-active peptides containing 75% Alamethicin F 50/5 and 10% Alamethicin F 50/7. Alamethicin F 50 exhibits antifungal and antibacterial activity by disrupting the integrity of microbial cell membranes, leading to leakage of cellular contents and microbial death. Alamethicin F 50 can reduce the surface…
Alarelin acetate is a synthetic GnRH agonist. Product Information Product Name Alarelin Acetate Molecular Weight 1287.42 Formula C60H86N16O16 CAS Number 79561-22-1 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture)
Product Name Angiotensin (1-12) (human) Biological activity Angiotensin (1-12) (human) is an endogenous substrate for the production of biologically active angiotensin peptides by a non-renin-dependent mechanism. CAS Number 136865-09-3 Sequence Sequence Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile Sequence Shortening Sequence Shortening DRVYIHPFHLVI Storage Please store the product under the recommended conditions in the Certificate of Analysis.
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us