Insert HTML here
Showing 353–368 of 3705 results
Product Name β-Casomorphin, bovine TFA Biological activity β-Casomorphin, bovine TFA (β-Casomorphin-7 (bovine) TFA) is a opioid peptide with an IC50 of 14 ??M in an Opioid receptors binding assay. Molecular Weight 903.94 Formula Formula C43H56F3N7O11 Sequence Sequence Tyr-Pro-Phe-Pro-Gly-Pro-Ile Sequence Shortening Sequence Shortening YPFPGPI Storage Please store the product under the recommended conditions in the Certificate…
Product Name [Nle11]-Substance P Biological activity -Substance P is a substance P analog that avoids methionine oxidation problems. Formula Formula C64H100N18O13 CAS Number 57462-42-7 Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-{NLE}-NH2 Sequence Shortening Sequence Shortening RPKPQQFFGL-{NLE}-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Adrenocorticotropic hormone (1-39), rat TFA Biological activity Adrenocorticotropic hormone (1-39), rat (TFA) is a potent melanocortin 2 (MC2) receptor agonist. Molecular Weight 4582.23 (free acid) Formula Formula C210H315N57O57S??xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Angiotensin II 5-valine is an agonist of angiotensin receptor. Product Information Product Name Angiotensin II 5-valine Molecular Weight 1032.15 Formula C49H69N13O12 CAS Number 58-49-1 Appearance Solid Color White to off-white Sequence Asp-Arg-Val-Tyr-Val-His-Pro-Phe Sequence Shortening DRVYVHPF Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6…
Angiotensin II human (Angiotensin II) acetate is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human acetate plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type…
Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type…
Angiotensin II human, FAM-labeled (Angiotensin II, FAM-labeled) is a FAM labeled Angiotensin II human (HY-13948). Product Information Product Name Angiotensin II human, FAM-labeled Molecular Weight 1517.64 Formula C77H92N14O19 Appearance Solid Color Yellow to orange Sequence {FAM-Ahx}-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe Sequence Shortening {FAM-Ahx}-DRVYIHPF Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent :…
Product Name Acetyl angiotensinogen (1-14), porcine Biological activity Acetyl angiotensinogen (1-14), porcine is a synthetic peptide and N-terminal acetylated form of Angiotensinogen (1-14) porcine (HY-P4774). CAS Number 66641-26-7 Sequence Sequence Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser Sequence Shortening Sequence Shortening Ac-DRVYIHPFHLLVYS Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Peptide YY (PYY) (3-36), porcine TFA Biological activity Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite. Appearance Solid Color White to off-white Sequence Sequence Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr Sequence Shortening Sequence Shortening AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years…
Product Name Intermedin (human) Biological activity Intermedin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1188922-20-4…
Product Name Big endothelin-1 (rat 1-39) Biological activity Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice. Sequence Sequence Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser (Disulfide bridge: Cys1-Cys15; Cys3-Cys11) Sequence Shortening Sequence Shortening CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11) Storage…
Product Name Galanin (2-29) (rat) Biological activity Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM). CAS Number 141696-11-9 Sequence Sequence Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 Sequence Shortening Sequence Shortening WTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P(1-7) TFA Biological activity Substance P(1-7) TFA is a fragment of the neuropeptide, substance P (SP). Substance P(1-7) TFA gives depressor and bradycardic effects when applied to the nucleus tractus solitarius. Formula Formula C43H66F3N13O12 CAS Number 2828433-22-1 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe Sequence Shortening Sequence Shortening RPKPQQF Storage…
Product Name Neuropeptide S(Rat) TFA Biological activity Neuropeptide S(Rat) TFA is a potent endogenous neuropeptide S receptor (NSPR) agonist (EC50=3.2 nM). Neuropeptide S(Rat) TFA increases locomotor activity and wakefulness in mice. Neuropeptide S(Rat) TFA also reduces anxiety-like behavior in mice. Sequence Shortening Sequence Shortening SFRNGVGSGVKKTSFRRAKQ Storage Please store the product under the recommended conditions in…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Diabetes Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ETDLLDIRSEY-OH Specifications: 11mer peptide as TFA salt
Anoplin is an antimicrobial peptide present in the venom of the solitary wasp (Anoplius samariensis). Anoplin exhibits antibacterial activity against a variety of bacteria, including Gram-positive and Gram-negative bacteria. Anoplin can be used in the development of antibiotics. Product Details Product Name Anoplin Biological activity Anoplin is an antimicrobial peptide found in the venom of…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us