Insert HTML here
Showing 273–288 of 3705 results
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-FASHVSPEV-OH Specifications: 9mer peptide as TFA salt
Product Name Adrenomedullin (AM) (1-52), human TFA Biological activity Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer. Formula Formula C264H406N80O77S3.xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21) Sequence Shortening Sequence Shortening YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21) Storage Sealed storage, away from moisture and light Powder -80??C 2…
Product Name Neuropeptide Y(29-64) Biological activity Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y. Formula Formula C189H284N54O58S CAS Number 303052-45-1 Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent :…
Product Name GLP-1(32-36)amide Biological activity GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice. Molecular Weight 570.73 Formula Formula C25H50N10O5 CAS Number 1417302-71-6 Appearance Solid Color White to off-white Sequence Sequence Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening LVKGR-NH2
Product Name Carperitide Biological activity Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way. Molecular Weight 3080.44 Formula…
Product Name GLP-1(7-37) acetate Biological activity GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Formula Formula C151H228N40O47.xC2H4O2 CAS Number 1450806-98-0 Appearance Solid Color White to off-white Sequence Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly Sequence Shortening Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In…
Product Name GLP-2(rat) (Ala-13C3,15N) TFA Biological activity GLP-2(rat) (Ala-13C3,15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Molecular Weight 3800.11 (free acid) Formula Formula C16313C3H256N4315NO56S.xC2HF3O2 Sequence…
Product Name C-Peptide, dog Biological activity C-Peptide, dog is a component of proinsulin, released from pancreatic beta cells into blood together with insulin. Formula Formula C137H225N37O49 CAS Number 39016-05-2 Sequence Sequence Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln Sequence Shortening Sequence Shortening EVEDLQVRDVELAGAPGEGGLQPLALEGALQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Caerulein, desulfated TFA Biological activity Caerulein, desulfated TFA is the desulfurated form of Caerulein. Caerulein is a decapeptide having the same five carboxyl-terminal amino acids as gastrin and cholecystokinin (CCK). Appearance Solid Color White to off-white Sequence Sequence {Glp}-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening {Glp}-QDYTGWMDF-NH2 Storage Sealed storage, away from moisture Powder -80??C 2…
Product Name Substance P (1-9) Biological activity Substance P (1-9) is nonapeptide, which decreases the inactivation of substance P by the guinea-pig ileum and urinary bladder. Formula Formula C52H77N15O12 CAS Number 57468-17-4 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly Sequence Shortening Sequence Shortening RPKPQQFFG Storage Sealed storage, away from moisture and light, under…
Product Name GIP, rat TFA Biological activity GIP, rat TFA is a bioactive peptide derived from rats. GIP, rat TFA inhibits GIP-mediated postprandial insulin release as well as GIP-promoted glucose uptake in the upper small intestine. GIP, rat TFA can be used in research related to insulin resistance, glucose intolerance, and type 2 diabetes. Molecular…
Product Name Penta-alanine Biological activity Penta-alanine (Penta-L-alanine) is a petide. Penta-alanine can be used for neurological disease research. CAS Number 10183-34-3 Sequence Sequence Ala-Ala-Ala-Ala-Ala Sequence Shortening Sequence Shortening AAAAA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Pancreatic Polypeptide, human Biological activity Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist. Molecular Weight 4181.71 Formula Formula C185H287N53O54S2 CAS Number 75976-10-2 Appearance Solid Color White to off-white Sequence Sequence Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Product Name Allatostatin IV Biological activity Allatostatin IV is an octapeptide. Allatostatins are pleiotropic neuropeptides for inhibition of juvenile hormone synthesis in insects. CAS Number 123338-13-6 Sequence Sequence Asp-Arg-Leu-Tyr-Ser-Phe-Gly-Leu-NH2 Sequence Shortening Sequence Shortening DRLYSFGL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Galanin (1-30), human Biological activity Galanin (1-30), human is a 30-amino acid neuropeptide, and acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM. Molecular Weight 3157.46 Formula Formula C139H210N42O43 CAS Number 119418-04-1 Appearance Solid Color White to off-white Sequence Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser Sequence Shortening Sequence Shortening GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Product Name Carperitide acetate Biological activity Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way. Molecular Weight 3140.5 Formula Formula C129H207N45O41S3 CAS…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us