Insert HTML here
Showing 2897–2912 of 3705 results
N-Acetyl semax amidate is a derivative of Semax (HY-P1146) (Met-Glu-His-Phe-Pro-Gly-Pro) obtained via N-terminal acetylation and C-terminal amidation, and it exhibits nootropic and neuroprotective activities. N-Acetyl semax amidate exerts neuroprotective effects by upregulating the expression of BDNF and NGF, inhibiting neuronal apoptosis, alleviating oxidative stress, and reducing glutamate excitotoxicity. N-Acetyl semax amidate can be used in…
Product Name Secretin, canine Biological activity Secretin, canine is an endocrine hormone that stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway. CAS Number 110786-77-1 Sequence Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 Sequence Shortening Sequence Shortening HSDGTFTSELSRLRESARLQRLLQGLV-NH2 Storage Please store the…
Product Name SDKPDMAEIEKFDKSK Biological activity SDKPDMAEIEKFDKSK is a peptide derived from thymosin β4 (Tβ4). Formula Formula C80H130N20O29S CAS Number 1339864-27-5 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening SDKPDMAEIEKFDKSK Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage,…
Product Name AWL 60 Biological activity AWL 60 is a compound with SP antagonist and weak opioid agonist properties, which can antagonize SP-agonists in vitro and attenuate the decrease in blood pressure caused by SP-agonists in vivo. CAS Number 140716-14-9 Sequence Sequence Tyr-Pro-{D-Phe}-Phe-{D-Phe}-{D-Trp}-Met-NH2 Sequence Shortening Sequence Shortening YP-{D-Phe}-F-{D-Phe}-{D-Trp}-M-NH2 Storage Please store the product under the…
N2W2 is a tryptophan- and lysine-rich ??-hairpin antimicrobial peptide. N2W2 has potent antibacterial activity but also high toxicity. N2W2 is highly sensitive to trypsin or chymotrypsin. N2W2 can be used in research on bacterial infections. Product Details Product Name N2W2 Biological activity N2W2 is a tryptophan- and lysine-rich ??-hairpin antimicrobial peptide. N2W2 exhibits potent antimicrobial…
NA-CATH is an antibacterial peptide with potent antibacterial activity against Francisella novicida (EC50 = 1.54 ??g/mL). NA-CATH does not cause significant hemolysis even at 100 ??g/mL. NA-CATH is commonly used in research on bacterial infections. Product Details Product Name NA-CATH Biological activity NA-CATH is an antibacterial peptide with effective antibacterial activity against Francisella novicida (EC50…
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis. Product Information Product Name Nagrestipen Molecular Weight 7668.48 Formula C338H516N88O108S4 CAS Number 166089-33-4 Sequence Shortening SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50) Sequence Shortening…
NBI-6024, an altered peptide ligand (APL), is an epitope recognized by inflammatory interferon-gamma-producing T helper lymphocytes in type 1 diabetic patients. Product Information Product Name NBI-6024 Molecular Weight 2390.73 Formula C106H180N28O34 CAS Number 239480-61-6 Sequence Shortening SHLVEALALVAGERG Sequence Shortening SHLVEALALVAGERG
Nelipepimut-S (E75) is a peptide vaccine targeting HER2. When used in combination with granulocyte-macrophage colony-stimulating factor, Nelipepimut-S stimulates immune activity and induces anti-HER2 immune responses. Nelipepimut-S can be used in research related to breast cancer, triple-negative breast cancer and ductal carcinoma in situ. Product Information Product Name Nelipepimut-S Molecular Weight 995.21 Formula C50H78N10O11 CAS Number…
Nemifitide diTFA (INN 00835 diTFA) is a 5-HT2A receptor ligand that crosses the blood-brain barrier. Nemifitide diTFA is used in research related to major depressive disorder. Product Information Product Name Nemifitide diTFA Molecular Weight 922.80 Formula C37H45F7N10O10 CAS Number 204992-09-6 Appearance Solid Color White to off-white Sequence {Fluoro-Phe}-{Hyp}-Arg-Gly-Trp-NH2 Sequence Shortening {Fluoro-Phe}-{Hyp}-RGW-NH2 Storage Sealed storage, away…
NEMURI is an antimicrobial peptide with sleep-promoting effects. Product Details Product Name NEMURI Biological activity NEMURI is an antimicrobial peptide with sleep-promoting effect. Sequence Shortening DARARRIVRAGRRRGGRRGGRRGGRRSARKS Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Thymus peptide C Biological activity Thymus peptide C is a hormonal agent derived from the thymus glands of young calves, which works as a substitute for the physiological functions of the thymus. Appearance Solid Color White to off-white Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Des-threoninol-octreotide Biological activity Des-threoninol-octreotide (Compound 13) is a Somatostatin analog. Des-threoninol-octreotide inhibits cloned somatostatin receptors with IC50 values of 13.62 nM, 10.63 nM, 10.95 nM for mSSTR2b, rSSTR5 and hSSTR5, respectively. Formula Formula C45H57N9O9S2 CAS Number 160841-00-9 Sequence Sequence {d-Phe}-Cys-Phe-{d-Trp}-Lys-Thr-Cys (Disulfide bridge: Cys2-Cys7) Sequence Shortening Sequence Shortening {d-Phe}-CF-{d-Trp}-KTC (Disulfide bridge: Cys2-Cys7) Storage Please…
Nesiritide (Brain Natriuretic Peptide-32 human) is a recombinant human B-type natriuretic peptide. Nesiritide is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide shows vasodilatory, diuretic, and natriuretic activities. Nesiritide is used in cardiovascular diseases such as heart…
Nesiritide (Brain Natriuretic Peptide-32 human) acetate is a recombinant human B-type natriuretic peptide. Nesiritide acetate is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide acetate regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide acetate shows vasodilatory, diuretic, and natriuretic activities. Nesiritide acetate is used in…
Product Name Isotocin Biological activity Isotocin is the homologue of mammalian oxytocin in teleost fish, belonging to the category of neurotransmitters/neuromodulators and peripheral hormones. Isotocin exerts biological effects by binding to its homologous isotocin receptor (with EC50 = 1.58e-10 mol/L in gilthead seabream) and specific G-protein-coupled receptor subtypes. Isotocin promotes paternal behavior in cichlids, regulates…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us