OFFICIAL STATEMENT-Regarding Fraudulent Websites

store

  • MOTS-c (human)

    MOTS-c (human)

    MOTS-c (human) is a mitochondrial-derived peptide that modulates the AMPK/PGC-1α pathway to enhance insulin sensitivity. MOTS-c (human) inhibits the folate cycle and de novo purine synthesis, increases AICAR levels to activate AMPK, and then regulates the Nrf2/Keap1 antioxidant pathway and inhibits the NF-??B inflammatory pathway, while promoting mitochondrial biogenesis and energy metabolism. MOTS-c (human) has…

    Read moreDone
  • MOTS-c (mouse)

    MOTS-c (mouse)

    MOTS-c (mouse) is a mitochondrial-derived polypeptide that can be used to regulates pancreatic cell function. MOTS-c (mouse) reduces insulin secretion and expression in INS-1E cells, and enhances glucagon secretion and expression in αTC-1 cells. MOTS-c (mouse) decreases the apoptosis in INS-1E and αTC-1. MOTS-c (mouse) counteracts diet-induced obesity and insulin resistance through AMPK activation. Product…

    Read moreDone
  • MOTS-c peptide (K14Q Mutation)

    MOTS-c peptide (K14Q Mutation)

    Amount: 1 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Other Purity: >90% (HPLC-MS) Quantification: No Sequence: H-MRWQEMGYIFYPRQLR-OH Specifications: 16mer cancer peptide

    Read moreDone
  • MOTS-c peptide, CAS 1627580-64-6

    MOTS-c peptide, CAS 1627580-64-6

    Amount: 1 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Mitochondrial-derived peptide MOTS-c Purity: >90% (HPLC-MS) Quantification: No Sequence: H-MRWQEMGYIFYPRKLR-OH Specifications: 16mer cancer peptide

    Read moreDone
  • Mouse (Survivin)

    Mouse (Survivin)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Mouse Protein Name: Baculoviral IAP repeat-containing protein (BIRC) Purity: >70% (HPLC-MS), Development Grade: each…

    Read moreDone
  • Mpox virus (Protein OPG095)

    Mpox virus (Protein OPG095)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection, Mpox Layout: Freeze-dried in glass vial Organism: Mpox virus (MPXV) Protein Name: Protein L1 Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence:…

    Read moreDone
  • Mpox virus (Protein OPG108)

    Mpox virus (Protein OPG108)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection, Mpox, Zoonosis Layout: Freeze-dried in glass vial Organism: Mpox virus (MPXV) Protein Name: Envelope protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No…

    Read moreDone
  • Mpox virus (Protein OPG190)

    Mpox virus (Protein OPG190)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection, Mpox, Zoonosis Layout: Freeze-dried in glass vial Organism: Mpox virus (MPXV) Protein Name: Protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence:…

    Read moreDone
  • Mpox virus mRNA-capping enzyme regulatory subunit OPG124 251-259, RVYEALYYV

    Mpox virus mRNA-capping enzyme regulatory subunit OPG124 251-259, RVYEALYYV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Mpox virus (MPXV) Protein Name: mRNA-capping enzyme Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-RVYEALYYV-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Mpox virus Protein OPG064 249-257, KIDYYIPYV

    Mpox virus Protein OPG064 249-257, KIDYYIPYV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Mpox virus (MPXV) Protein Name: Protein OPG Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KIDYYIPYV-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Mpox virus Putative nuclease OPG089 18-26, ILDDNLYKV

    Mpox virus Putative nuclease OPG089 18-26, ILDDNLYKV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Mpox virus (MPXV) Protein Name: Putative nuclease OPG089 Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ILDDNLYKV-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Mpox virus RNA-binding protein OPG065 103-110, VGPSNSPTF

    Mpox virus RNA-binding protein OPG065 103-110, VGPSNSPTF

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Mpox virus (MPXV) Protein Name: RNA-binding protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-VGPSNSPTF-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Mpox virus Telomere-binding protein OPG077 211-219, RLYDYFTRV

    Mpox virus Telomere-binding protein OPG077 211-219, RLYDYFTRV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Mpox virus (MPXV) Protein Name: Telomere-binding protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-RLYDYFTRV-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • MPQPPAK

    MPQPPAK

    Product Name MTAAAR Biological activity MTAAAR is a polypeptide obtained from the enzymatic hydrolysis of C-phycocyanin (HY-D1025) and possesses neuroprotective activity. MTAAAR enhances the activities of antioxidant enzymes SOD, CAT, and GSH-Px, reduces ROS, inhibits apoptosis and acetylcholinesterase (AChE) activity in brain tissue, and decreases protein carbonyl content. In the MPTP (HY-W114750)-induced zebrafish Parkinson’s disease…

    Read moreDone
  • Mram 8

    Mram 8

    Mram 8 is a cyclic peptide isolated from the violet family plant Viola. Product Details Product Name Mram 8 Biological activity Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family. Sequence Cyclo(Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn-Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27) Sequence Shortening Cyclo(AIGCSCKSKVCYRNGIPCGESCVFIPCLTS) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27) Storage Please store the product under the recommended…

    Read moreDone
  • MTAAAR

    MTAAAR

    Product Name Neurogranin (48-76), human Biological activity Neurogranin (48-76), human is a dominant endogenous peptide in Alzheimer’s disease (AD) brain tissue. Neurogranin (48-76) is a potential biomarker for synaptic function in AD. Sequence Sequence Ser-Gly-Glu-Arg-Gly-Arg-Lys-Gly-Pro-Gly-Pro-Gly-Gly-Pro-Gly-Gly-Ala-Gly-Val-Ala-Arg-Gly-Gly-Ala-Gly-Gly-Gly-Pro-Ser Sequence Shortening Sequence Shortening SGERGRKGPGPGGPGGAGVARGGAGGGPS Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone