Insert HTML here
Showing 2929–2944 of 3705 results
Product Name Nocistatin Biological activity Nocistatin, a neuropeptide, is an endogenous ligand for the orphan opioid receptor-like receptor. Nocistatin is also a functional antagonist of neuropeptide nociceptin or orphanin FQ (Noc/OFQ). Nocistatin inhibits 5-HT release via a Gi/o proteinmediated pathway. Nocistatin blocks Nociceptin (Nociceptin)-induced allodynia and hyperalgesia. Molecular Weight 772.85 Formula Formula C32H56N10O12 CAS Number…
Product Name Bradykinin (1-3) Biological activity Bradykinin (1-3) is a 3-amino acid residue peptide. Bradykinin (1-3) is an amino-truncated Bradykinin peptide, cleaved by Prolyl endopeptidase. CAS Number 23815-91-0 Sequence Sequence Arg-Pro-Pro Sequence Shortening Sequence Shortening RPP Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Cyclic somatostatin acetate Biological activity Cyclic somatostatin (SRIF-14) acetate is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin acetate is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin acetate inhibits the…
Product Name [Nle8,18,Tyr34]-pTH (3-34) amide (human) Biological activity -pTH (3-34) amide human (hPTH (3-34) amide) is a parathyroid hormone (PTH) analog. CAS Number 120527-89-1 Sequence Sequence Ser-Glu-Ile-Gln-Leu-{Nle}-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-{Nle}-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Tyr-NH2 Sequence Shortening Sequence Shortening SEIQL-{Nle}-HNLGKHLNS-{Nle}-ERVEWLRKKLQDVHNY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Type A Allatostatin I Biological activity Type A Allatostatin I is a tridecapeptide. Allatostatins are pleiotropic neuropeptides for inhibition of juvenile hormone synthesis in insects. CAS Number 123209-95-0 Sequence Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2 Sequence Shortening Sequence Shortening APSGAQRLYGFGL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P TFA Biological activity Substance P TFA (Neurokinin P TFA) is a CNS-penetrant neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R). Molecular Weight 1461.65 Formula Formula C65H99F3N18O15S CAS Number 148470-19-3 Appearance Solid Color White to off-white…
Product Name Peptide YY (pig) Biological activity Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular…
Product Name Neuropeptide DF2 Biological activity Neuropeptide DF2 is a DRNFLRFamide neuropeptide orignally isolated from crayfish. which enhances transmitter release and stimulates the amplitude of excitatory post-synaptic potentials (EPSP) through the calcium/calmodulin-dependent protein kinase. CAS Number 149471-11-4 Sequence Sequence Asp-Arg-Asn-Phe-Leu-Arg-Phe-NH2 Sequence Shortening Sequence Shortening DRNFLRF-NH2 Storage Please store the product under the recommended conditions in…
Product Name Hepcidin-1 (mouse) TFA Biological activity Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA…
Product Name β-Casomorphin (1-5), bovine TFA Biological activity β-Casomorphin (1-5), bovine (TFA) is a peptide of bovine β-Casomorphin. CAS Number 2828433-20-9 Sequence Sequence Tyr-Pro-Phe-Pro-Gly Sequence Shortening Sequence Shortening YPFPG Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name MPQPPAK Biological activity MPQPPAK is a polypeptide obtained from the enzymatic hydrolysis of C-phycocyanin (HY-D1025) and possesses neuroprotective activity. MPQPPAK enhances the activities of antioxidant enzymes SOD, CAT, and GSH-Px, reduces ROS, inhibits apoptosis and acetylcholinesterase (AChE) activity in brain tissue, and decreases protein carbonyl content. In the MPTP (HY-W114750)-induced zebrafish Parkinson’s disease…
Product Name (D-Ser1)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) Biological activity (D-Ser1)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) is an adrenocorticotropic hormone (ACTH) analogue. Formula Formula C136H210N40O31S CAS Number 18067-65-7 Appearance Solid Color White to off-white Sequence Sequence {d-Ser}-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro Sequence Shortening Sequence Shortening {d-Ser}-YSMEHFRWGKPVGKKRRPVKVYP Storage Sealed storage, away from moisture Powder…
Product Name Obestatin(human) TFA Biological activity Obestatin(human) TFA is an endogenous peptide derived from the same prepropeptide as ghrelin. Obestatin(human) suppresses food intake and reduce body weight-gain in rats. Sequence Shortening Sequence Shortening FNAPFDVGIKLSGVQYQQHSQAL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name N-Acetyloxytocin Biological activity N-Acetyloxytocin is isolated and characterized in the neurointermediate lobe of the rat pituitary (NIL) and their presence in several brain areas of the rat. Formula Formula C45H68N12O13S2 CAS Number 10551-48-1 Appearance Solid Color White to off-white Sequence Sequence Ac-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening Ac-CYIQNCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed…
Product Name Neuropeptide S (Mouse) TFA Biological activity Neuropeptide S(Mouse) TFA is a potent endogenous neuropeptide S receptor (NPSR) agonist (EC50=3 nM). Neuropeptide S(Mouse) TFA induces mobilization of intracellular Ca2+. Neuropeptide S(Mouse) TFA increases locomotor activity and wakefulness in mice. Neuropeptide S(Mouse) TFA also reduces anxiety-like behavior in mice. Sequence Sequence Ser-Phe-Arg-Asn-Gly-Val-Gly-Ser-Gly-Ala-Lys-Lys-Thr-Ser-Phe-Arg-Arg-Ala-Lys-Gln (TFA) Sequence Shortening…
Product Name Pancreatic polypeptide TFA Biological activity Pancreatic polypeptide TFA is a neuropeptide Y (NPY) Y4/Y5 receptor agonist. Appearance Solid Color White to off-white Sequence Sequence Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us