Product Name Urocortin, human Biological activity Urocortin, human, a 40-aa neuropeptide, acts as an agonist of endogenous CRF receptor, with Kis of 0.4, 0.3, and 0.5 nM for hCRF1, rCRF2α and mCRF2β, respectively. Molecular Weight 4696.24 Formula Formula C204H337N63O64 CAS Number 176591-49-4 Appearance Solid Color White to off-white Sequence Sequence Asp-Asn-Pro-Ser-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2 Sequence Shortening Sequence Shortening…
Product Name Secretin (swine) Biological activity Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which acts on secretin receptors. Secretin is expressed by cells in all mature enteroendocrine…
Product Name IGF-I (24-41) Biological activity IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) is amino acids 24 to 41 fragment of IGF-I. IGF-I, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I is partly responsible for systemic growth hormone (GH) activities. IGF-I has anabolic, antioxidant, anti-inflammatory and cytoprotective…
Product Name PACAP (1-38), amide, Biotin-labeled Biological activity PACAP (1-38), amide, Biotin-labeled is a biological active peptide. (Biotin-labeled HY-P0221) Appearance Solid Color White to off-white Sequence Sequence {Biotin}-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 Sequence Shortening Sequence Shortening {Biotin}-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C,…
Product Name Neuropeptide K (human, porcine, rat) Biological activity Neuropeptide K, human, porcine, rat exhibits bioactivity in gallbladder contraction, protein extravasation, hypotension and brcnchial smooth muscle spasm. Neuropeptide K, human, porcine, rat is concentrated in brain and acts as tachykinin neuromessenger. CAS Number 96827-05-3 Sequence Sequence Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2 Storage Please store…
Product Name Adrenocorticotropic hormone Biological activity Adrenocorticotropic hormone (ACTH; Adrenocorticotrophic hormone) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone stimulates cortisol secretion from the adrenal cortex via the hypothalamic-pituitary-adrenal (HPA) axis. Adrenocorticotropic hormone regulates cortisol and androgen production. Adrenocorticotropic hormone can promote the development of spermatogenesis. Adrenocorticotropic hormone can relieve…
Product Name β-Endorphin (rat) Biological activity β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction. CAS Number 309246-19-3 Appearance Solid Color White to…
Product Name Angiotensinogen (1-13) (human) Biological activity Angiotensinogen (1-13) (human) is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides. CAS Number 82048-97-3 Sequence Sequence Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His Sequence Shortening Sequence Shortening DRVYIHPFHLVIH Storage Please store the product under the recommended conditions in the Certificate…
Product Name Amylin (8-37), human Biological activity Amylin (8-37), human is a fragment of human Amylin. Amylin (8-37), human has direct vasodilator effects in the isolated mesenteric resistance artery of the rat. Human Amylin is a small hormone secreted by pancreatic β-cells that forms aggregates under insulin deficiency metabolic conditions, and it constitutes a pathological…
Product Name Parathyroid Hormone (1-34), human, biotinylated Biological activity Parathyroid Hormone (1-34), human, biotinylated is a probe for the parathyroid hormone receptor, can be used for analyzing the interaction between parathyroid hormone and parathyroid hormone receptors in living cells and for purifying hormone-receptor complexes with affinity columns. Appearance Solid Color White to off-white Sequence Sequence…
Product Name Serum thymic factor Biological activity Serum thymic factor (Thymulin) is a zinc-dependent immunoregulatory peptide hormone produced by thymic epithelial cells. Serum thymic factor stimulates the release of hormones from the pituitary gland and exhibits pituitary-promoting activity. Serum thymic factor protects rats from Cephaloridine (HY-B2072)-induced nephrotoxicity by inhibiting ERK activation. Serum thymic factor possesses…
Product Name pTH-Related Protein (1-34) amide (human, mouse, rat) Biological activity pTH-Related Protein (1-34) amide (human, mouse, rat) (Human PTHrP-(1-34)NH2) is a N-terminal fragments of PTHrP. pTH-Related Protein (1-34) amide (human, mouse, rat) induces hypercalcemia, and can be used for research of humoral hypercalcaemia of malignancy. CAS Number 112955-31-4 Appearance Solid Color White to off-white…
Product Name Neurotensin (1-8) Biological activity Neurotensin (1-8) is a polypeptide and an N-terminal metabolite fragment of Neurotensin (NT 1-13) that can be detected as a stable circulating metabolite. Neurotensin (1-8) is useful for research related to neurotensin metabolism and gastrointestinal endocrinology. Formula Formula C46H71N13O14 CAS Number 80887-44-1 Sequence Sequence {Pyr}-Leu-Tyr-Glu-Asn-Lys-Pro-Arg Sequence Shortening Sequence Shortening…
Product Name CRF, bovine Biological activity CRF, bovine is a potent agonist of CRF receptor, and displaces ovine CRF with a Ki of 3.52 nM. Molecular Weight 4697.34 Formula Formula C206H340N60O63S CAS Number 92307-52-3 Sequence Sequence Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 Sequence Shortening Sequence Shortening SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Product Name α-CGRP (human) TFA Biological activity α-CGRP (human) (TFA) is a regulatory neuropeptide of 37 amino acids. α-CGRP (human) (TFA) is widely distributed in the central and peripheral nervous system. α-CGRP (human) (TFA) is a potent vasodilator and has inotropic and chronotropic effects. Formula Formula C163H267N51O49S2??xC2HF3O2 Appearance Solid Color White to off-white Sequence Sequence…
Product Name Bradykinin (1-5) Biological activity Bradykinin (1-5) is a metabolite of Bradykinin (HY-P0206) and a PAR inhibitor that inhibits thrombin-induced platelet aggregation by preventing protease-activated receptor (Protease Activated Receptor) cleavage and inhibiting Thrombin (MW 37kDa) (HY-114164). Bradykinin (1-5) is used in research on thrombosis, carrageenan-induced pleurisy, nasal allergy, and hereditary angioedema. Molecular Weight 572.66…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
