Insert HTML here
Showing 353–368 of 490 results
Poterepatide (HDM1005) is a GLP-1R/GIPR dual agonist. Poterepatide preferentially reduces fat mass and improves hepatic steatosis in a dose-dependent manner, improving lipid metabolism and liver function. Poterepatide can be used in research on type 2 diabetes, obesity, and metabolic dysfunction-associated steatohepatitis. Product Information Product Name Poterepatide Molecular Weight 5199.94 Formula C243H382N52O73 CAS Number 3058127-20-8 Appearance…
Pramlintide is a polypeptide analogue of human amylin. Pramlintide, an antidiabetic agent, is antineoplastic in colorectal cancer. Product Information Product Name Pramlintide Molecular Weight 3949.39 Formula C171H267N51O53S2 CAS Number 151126-32-8 Appearance Solid Color White to off-white Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) Sequence Shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7) Storage Sealed storage, away from moisture Powder -80??C 2 years…
Pramlintide acetate is a polypeptide analogue of human amylin. Pramlintide acetate, an antidiabetic agent, is antineoplastic in colorectal cancer. Product Information Product Name Pramlintide acetate Molecular Weight 3949.39 (free base) Formula C171H267N51O53S2.xC2H4O2 CAS Number 187887-46-3 Appearance Solid Color White to off-white Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) Sequence Shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7) Storage Sealed storage, away from…
Pramlintide TFA is a polypeptide analogue of human amylin. Pramlintide TFA, an antidiabetic agent, is antineoplastic in colorectal cancer. Product Information Product Name Pramlintide TFA Molecular Weight 3949.39 (free base) Formula C171H267N51O53S2.xC2HF3O2 Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) Sequence Shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
PRO20 is a specific and competitive (pro)renin receptor (PRR) antagonist. PRO20 inhibits Prorenin-induced calcium influx with an IC50 value of 81 nmol/L. PRO20 exerts antihypertensive activity by blocking the binding of prorenin to the PRR, inhibiting the activation of the renin-angiotensin system (RAS), and reducing the production of angiotensin II (Ang II). PRO20 is promising…
Proinsulin C-peptide (human) is a peptide consisting of 31 amino acids that links the A and B chains of proinsulin to ensure its correct folding. Proinsulin C-peptide (human) inhibits the high glucose-induced increase in PDGF-β receptor protein expression and the phosphorylation of p42/p44 MAP kinase. Proinsulin C-peptide (human) increases the deformability of erythrocytes derived from…
Protein Kinase C (beta) Peptide is a peptide fragment of Protein Kinase Cβ. Protein Kinase Cβ is related with hyperglycemia decreases endothelium-derived nitric oxide. Inhibition of Protein kinase Cβ prevents the reduction in endothelium-dependent vasodilation induced by acute hyperglycemia. Product Information Product Name Protein Kinase C β Peptide Molecular Weight 1966.18 Formula C84H136N22O30S CAS Number…
Protirelin is a highly conserved neuropeptide that exerts the hormonal control of thyroid-stimulating hormone (TSH) levels as well as neuromodulatory functions. Product Information Product Name Protirelin Molecular Weight 362.38
Protirelin Acetate is a highly conserved neuropeptide that exerts the hormonal control of thyroid-stimulating hormone (TSH) levels as well as neuromodulatory functions. Product Information Product Name Protirelin acetate Molecular Weight 452.46 Formula C16H22N6O4.3/2C2H4O2 CAS Number 120876-23-5 Appearance Solid Color White to off-white Sequence {pGlu}-His-Pro-NH2 Sequence Shortening {pGlu}-HP-NH2 Storage Sealed storage, away from moisture Powder -80??C…
Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits . Product Information Product Name Quinupristin Molecular Weight 1022.22 Formula C53H67N9O10S CAS Number 120138-50-3 Appearance Solid Color White to off-white Sequence Shortening T-Abu-PF-Pip-Phg (Lactone:Thr1-Phg6) Sequence…
Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits. Product Information Product Name Quinupristin mesylate Molecular Weight 1118.32 Formula C54H71N9O13S2 Sequence Shortening T-Abu-PF-Pip-Phg (Lactone:Thr1-Phg6) Sequence Shortening T-Abu-PF-Pip-Phg (Lactone:Thr1-Phg6)
R2R01 is a potent and selective relaxin family peptide receptor 1 (RXFP1) agonist with an EC50 of 0.34 nM. R2R01 activates RXFP1 to induce relaxin-like biological responses. R2R01 can increase heart rate in pithed and conscious rats. R2R01 can be used for the research of cardiovascular diseases. Product Information Product Name R2R01 Molecular Weight 4361.12…
Relamorelin (RM-131), a pentapeptide ghrelin analog, is a selective ghrelin/growth hormone secretagogue receptor (GHSR) agonist with a Ki of 0.42 nM for GHS-1a receptor. Relamorelin is centrally penetrant. Relamorelin increases growth hormone levels and accelerates gastric emptying. Relamorelin has the potential for cachexia, gastroparesis, and gastric/intestinal dysmobility disorders research. Product Information Product Name Relamorelin Molecular…
Relamorelin (RM-131) acetate, a pentapeptide ghrelin analog, is a selective ghrelin/growth hormone secretagogue receptor (GHSR) agonist with a Ki of 0.42 nM for GHS-1a receptor. Relamorelin acetate is centrally penetrant. Relamorelin acetate increases growth hormone levels and accelerates gastric emptying. Relamorelin acetate has the potential for cachexia, gastroparesis, and gastric/intestinal dysmobility disorders research. Product Information…
Relamorelin (RM-131) TFA, a pentapeptide ghrelin analog, is a selective ghrelin/growth hormone secretagogue receptor (GHSR) agonist with a Ki of 0.42 nM for GHS-1a receptor. Relamorelin TFA is centrally penetrant. Relamorelin TFA increases growth hormone levels and accelerates gastric emptying. Relamorelin TFA has the potential for cachexia, gastroparesis, and gastric/intestinal dysmobility disorders research. Product Information…
Reltecimod (AB-103) is a T-cell-specific surface glycoprotein CD28 (TP44) antagonist. Reltecimod has beneficial effects against different bacterial infections, their exotoxins and endotoxins, and ionizing radiation. Reltecimod modulates the inflammatory response by targeting and attenuating the critical CD28/B7-2 co-stimulatory pathway, without inhibiting it. Reltecimod can be used to research necrotizing soft-tissue infections (NSTIs). Product Information Product…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Therapeutic Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us