Insert HTML here
Showing 97–112 of 883 results
![[His11]Substance P](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides5-300x300.jpg)
Product Name PHI-27 (rat) Biological activity PHI-27 (rat) is a 27 amino acid peptide.PHI-27 (rat) is used to find peptide hormones and other active peptides. CAS Number 96849-38-6 Sequence Sequence His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2 Sequence Shortening Sequence Shortening HADGVFTSDYSRLLGQISAKKYLESLI-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Neuropeptide AF (cattle) Biological activity Neuropeptide AF (cattle), an amidated octadecapeptide, is RFamide neuropeptide. Neuropeptide AF (cattle) acts as a ligand of Mas-related gene receptor A4 (MrgprA4) (Mas-related G-protein-coupled Receptor (MRGPR)) (EC50 of ~60 nM) and MrgprC11 (EC50 of ~300 nM). Neuropeptide AF (cattle) also activate to the G protein-coupled receptors NPFF1 (Neuropeptide…
Product Name GRP (porcine) Biological activity GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in…
Product Name Lysipressin acetate Biological activity Lysipressin acetate (Lysine vasopressin acetate; -Vasopressin acetate) is a neurohypophyseal nonapeptide with dual cardiovascular regulatory activities of peripheral pressor action and central hypotensive action, and it also regulates pain perception in the body. Lysipressin acetate is an Oxytocin Receptor agonist, with a Ki value of 10.2 nM for porcine…
Product Name (D-Phe7)-α-MSH Biological activity (D-Phe7)-α-MSH is an α-MSH analogue. Formula Formula C77H109N21O19S CAS Number 92937-43-4 Sequence Shortening Sequence Shortening Ac-SYSMEH-{d-Phe}-RWGKPV-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-Trp32)-Neuropeptide Y (porcine) Biological activity (D-Trp32)-Neuropeptide Y (porcine) is a highly selective neuropeptide Y (NPY) Y5 receptor agonist. (D-Trp32)-Neuropeptide Y (porcine) has orexigenic activity and inhibits Forskolin (HY-15371)-stimulated cAMP formation. Formula Formula C197H290N56O56 CAS Number 153549-78-1 Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-{d-Trp}-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDLARYYSALRHYINLI-{d-Trp}-RQRY-NH2 Storage Please store the product under the recommended conditions…
Product Name [D-Leu6, Val7]-LH-RH (1-9) Ethyl Amide Biological activity -LH-RH (1-9) Ethyl Amide is a LHRH peptide analogue. Sequence Shortening Sequence Shortening {Glp}-HWSY-{d-Leu}-VRP-NHEt Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Pmp1,DTyr(OEt)2,Val4,Cit8] Vasopressin Biological activity Vasopressin is an analogue of Vasopressin. CAS Number 1426174-49-3 Sequence Shortening Sequence Shortening Pmp-y(OEt)-FVNCP-Cit-G-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Amylin (8-37) (human) Biological activity Amylin (8-37) (human) (hIAPP (8-37)) is a 8-37 fragment of human islet amyloid polypeptide (IAPP). The duplex folding structure in the Amylin (8-37) (human) assembly has a hairpin structure. Formula Formula C138H215N41O46 CAS Number 309244-90-4 Sequence Shortening Sequence Shortening ATQRLANFLVHSSNNFGAILSSTNVGSNTY Storage Please store the product under the recommended…
Product Name Neuropeptide Y (3-36) (porcine) Biological activity Neuropeptide Y (3-36) (porcine) is an agonist of neuropeptide Y (NPY) receptor subtype Y2, and stimulates feeding in rats. Neuropeptide Y (3-36) (porcine) is a highly Y2 selective ligand compared with nselective Y1/Y2 receptor ligand, Neuropeptide Y 1-36. Molecular Weight 3993.36 Formula Formula C176H271N53O54 CAS Number 143863-88-1…
Product Name BNP (22-46), Pro (Human) Biological activity BNP (22-46), Pro (Human) is an peptide . BNP (22-46), Pro (Human) can be used for the research of cardiac dysfunction. Sequence Shortening Sequence Shortening NHLQGKLSELQVEQTSLEPLQESPR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Brain Natriuretic Peptide (1-32), rat Biological activity Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes). Molecular Weight 3452.94 Formula Formula C146H239N47O44S3 CAS Number 133448-20-1 Sequence Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)…
Product Name Neuropeptide W-30 (human) Biological activity Neuropeptide W-30 (human) is an important stress mediator in the central nervous system that modulates the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. Neuropeptide W-30 (human) is an endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8. Neuropeptide W-30 (human) activates and binds to…
Product Name Calcitonin, porcine Biological activity Calcitonin, porcine inhibits 1,25 (OH)2D3-stimulated porcine osteoclast differentiation. Calcitonin is a polypeptide hormone that can lower serum calcium by decreasing calcium reabsorption in the kidney and inhibiting osteoclastic bone resorption. Calcitonin, porcine can be used for research of hypercalcemia. CAS Number 12321-44-7 Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Ser-Ala-Tyr-Trp-Arg-Asn-Leu-Asn-Asn-Phe-His-Arg-Phe-Ser-Gly-Met-Gly-Phe-Gly-Pro-Glu-Thr-Pro-NH2 (Disulfidebridge:Cys1-Cys7) Sequence Shortening Sequence…
Product Name Prosomatostatin (1-32), porcine Biological activity Prosomatostatin (1-32), porcine is a peptide with sequences overlapping, but not identical to, the neuronostatin peptide. Formula Formula C161H260N44O45 CAS Number 99694-34-5 Sequence Shortening Sequence Shortening APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Cyclic SSTR agonist octreotide Biological activity Cyclic SSTR agonist octreotide is a Octreotide (HY-P0036), serving as the cyclic Somatostatin Receptor SSTR agonist. Sequence Sequence Phe-Cys-Phe-Asp-Trp-Lys-Thr-Cys-Thr Sequence Shortening Sequence Shortening FCFDWKTCT Storage Please store the product under the recommended conditions in the Certificate of Analysis.
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us