Product Name Nesfatin-1 (24-53), human Biological activity Nesfatin-1 (24-53), human is a fragment of human Nesfatin-1. Human Nesfatin-1 protein can rapidly inhibit food intake. Appearance Solid Color White to off-white Sequence Sequence Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2 Sequence Shortening Sequence Shortening PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Product Name [Tyr12] Somatostatin 28 (1-14) Biological activity Somatostatin 28 (1-14) is an analogue of Somatostatin-28 (1-14) (HY-P1499). Somatostatin-28 (1-14) is an N-terminal fragment of the neuropeptide somatostatin-28. CAS Number 198276-46-9 Sequence Shortening Sequence Shortening SANSNPAMAPRYRK Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Biotinyl-Obestatin, rat Biological activity Biotinyl-Obestatin, rat is a polypeptide. CAS Number 1815618-11-1 Sequence Shortening Sequence Shortening Biotinyl-FNAPFDVGIKLSGAQYQQHGRAL-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name [Lys8] Vasopressin Desglycinamide Biological activity Vasopressin Desglycinamide is a vasopressin analog, used for the maintenance of active and passive avoidance behavior. Vasopressin Desglycinamide facilitates memory consolidation processes. Formula Formula C44H63N11O12S2 CAS Number 32215-99-9 Sequence Shortening Sequence Shortening CYFQNCPK Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Crustacean cardioactive peptide Biological activity Crustacean cardioactive peptide (CCAP) is a insect cardioregulatory peptides that contmns 9 amino acid, first isolated from the tobacco hawkmoth, Manduca sexta. There are two cystemes at pnsttons 3 and 9 forming a disulfide bridge and the carboxyl-terminns is amldated. Formula Formula C42H57N11O11S2 CAS Number 107090-96-0 Sequence Shortening…
Product Name Galanin (1-15) (porcine, rat) Biological activity Galanin (1-15) (porcine, rat) is the N-terminal 15 amino acids peptide fragment of the neuropeptide galanin. Galanin (1-15) (porcine, rat) interacts with the 5-HT1A receptor in the dorsal hippocampus of the rat brain, reduces the affinity of 5-HT1A receptors, and regulates the serotonin neuronal networks. Formula Formula…
Product Name α-MSH free acid Biological activity α-MSH free acid (α-Melanocyte-Stimulating Hormone free acid) is an MC3R and MC4R agonist with EC50s of 0.16 nM and 5.6 nM, respectively. α-MSH free acid activates cAMP generation at MC3R and MC4R. Formula Formula C77H108N20O20S CAS Number 10466-28-1 Storage Please store the product under the recommended conditions in…
Product Name [Lys5,Tyr6,mLeu9,Nle10]-Neurokinin A (4-10) Biological activity -Neurokinin A (4-10) (ID 305) is a selective NK2R agonist with an EC50 of 3.7 ?nM for hNK2R. -Neurokinin A (4-10) significantly inhibits weight loss in diet-induced obese (DIO) mice model and improves Loperamide (HY-156131)-induced dysfunctional voiding in wild-type mice. -Neurokinin A (4-10) can be used for neurokinin…
Product Name TLQP-62 (mouse,rat) Biological activity TLQP-62 (mouse,rat) is a secreted C-terminal peptide that can be derived from protein VGF. TLQP-62 activates the BDNF-TrkB signaling pathway, inducing acute, transient phosphorylation of TrkB receptor and downstream CREB (Ser133) phosphorylation. TLQP-62 demonstrates excellent efficacy in promoting long-term fear memory formationin wild-type mice and reversing memory impairment in…
Product Name Urotensin II, mouse TFA Biological activity Urotensin II, mouse TFA is an endogenous ligand for the orphan G-protein-coupled receptor GPR14 or SENR. Urotensin II, mouse TFA is a potent vasoconstrictor. Urotensin II, mouse TFA plays a physiological role in the central nervous system. Molecular Weight 1747.87 Formula Formula C78H101F3N18O21S2 Appearance Solid Color White…
Product Name [Tyr8,Nle11] Substance P Biological activity Substance P is a Substance P (HY-P0201) analog. Substance P is a peptide mainly secreted by neurons and is involved in many biological processes, including nociception and inflammation. CAS Number 71890-48-7 Sequence Shortening Sequence Shortening RPKPQQFYGL-{Nle}-NH2 Storage Please store the product under the recommended conditions in the Certificate…
Product Name Levitide Biological activity Levitide is a neurohormone-like peptide, can be isolated from skin secretions of the South African frog Xenopus laevis. Levitide comes from preprolevitide, is 88 residues long and contains contains the levitide peptide at the C terminus (Glu-Gly-Met-Ile-Gly-Thr-Leu-Thr-Ser-Lys-Arg-Ile-Lys-Gln-NH2) and the putative signal sequence at the N terminus. Formula Formula C66H119N21O19S CAS…
Product Name Kentsin Biological activity Kentsin (Thr-Pro-Arg-Lys), a contraceptive tetrapeptide, is originally extracted from hamster embryos. Kentsin prevents the maturation of Graafian follicles and consequently inhibits ovulation, without binding to opioid receptors. Kentsin has opiate properties on gastrointestinal motility. Molecular Weight 500.59 Formula Formula C21H40N8O6 CAS Number 56767-30-7 Sequence Shortening Sequence Shortening TPRK Storage Please…
Product Name [Leu3]-Oxytocin Biological activity -Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu). CAS Number 874701 Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Leu-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening CYLQNCPLG-NH2 (Disulfide bridge:Cys1-Cys6) Storage Sealed storage, away from moisture and light Powder -80??C 2 years…
Product Name (Des-Pyr1)-LHRH Biological activity (Des-Pyr1)-LHRH is a Polypeptide Internal Standard, identical to (Des-Pyr1)-GnRH, which can be identified through peptide screening. Peptide screening is a research tool that mainly collects active polypeptides via immunoassays. It can be applied to protein interaction, functional analysis, epitope screening, especially in the field of active molecule research and development….
Product Name [MePhe8,Sar9] Substance P Biological activity Substance P ( Substance P) is an analog of Substance P (HY-P0201). Substance P is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. CAS Number 77128-76-8 Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe(Nme)-{Sar}-Leu-Met–NH2 Sequence Shortening Sequence Shortening RPKPQQF-Phe(Nme)-{Sar}-LM-NH2 Storage Please store the product under the recommended conditions…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
![[D-Lys6]-LH-RH TFA](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides5-300x300.jpg)