Insert HTML here
Showing 497–512 of 883 results
Product Name Big Endothelin-1 (22-38), human Biological activity Big Endothelin-1 (22-38), human is derived from human, is the 22-38 fragment of Big Endothelin-1 (ET-1) (1-38). Big ET-1 (1-38) is a propeptide of ET-1, which has potent and long-lasting vasoconstrictor effects, equips a specific enzymatic cleavage of the 38 amino acid chain to form ET-1 (1-21)…
Product Name Helospectin I Biological activity Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum. Molecular Weight 4095.63 Formula Formula C183H293N47O59 CAS Number 93438-37-0 Sequence Shortening…
Product Name (Des-Gly10,D-Ala6,Pro-NHEt9)-LHRH (salmon) Biological activity (Des-Gly10,D-Ala6,Pro-NHEt9)-LHRH (salmon) is a GnRH analog that induces ovulation and/or spawning in farmed fish. CAS Number 88848-87-7 Appearance Solid Color White to off-white Sequence Sequence {Pyr}-His-Trp-Ser-Tyr-{d-Ala}-Trp-Leu-Pro-{NHEt} Sequence Shortening Sequence Shortening {Pyr}-HWSY-{d-Ala}-WLP-{NHEt} Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6…
Product Name Neuromedin B Biological activity Neuromedin B (NMB) is a member of Bombesin (BN)-like peptide family in mammals. Molecular Weight 1132.29 Formula Formula C52H73N15O12S CAS Number 87096-84-2 Appearance Solid Color White to off-white Sequence Sequence Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2
Product Name (Asp28)-Glucagon (1-29) (human, rat, porcine) Biological activity (Asp28)-Glucagon (1-29) (human, rat, porcine) is a glucagon analog and a GCGR agonist, with the Asn at position 28 replaced by Asp. (Asp28)-Glucagon (1-29) (human, rat, porcine) activates GCGR-mediated cAMP signaling, with EC50 values of 0.067 nM and 0.09 nM, respectively, and an EC50 of 7.99…
Product Name α-Casozepine Biological activity α-Casozepine is an orally effective anxiolytic that binds to the benzodiazepine site of the GABAA receptor in bovine samples with an IC50 of 88 ??M. α-Casozepine exerts anxiolytic and anti-stress effects on cats exposed to unfamiliar environments and dogs undergoing road transport. α-Casozepine exhibits significant anxiolytic activity in rats. α-Casozepine…
Product Name (Des-Gly10,D-Arg6,Pro-NHEt9)-LHRH II (chicken) Biological activity Des-Gly10,D-Arg6,Pro-NHEt9)-LHRH II (chicken) is an active petide. (Des-Gly10,D-Arg6,Pro-NHEt9)-LHRH II (chicken) can be used for the research of various biochemical studies. CAS Number 145940-57-4 Sequence Shortening Sequence Shortening {Glp}-HWSHRWYP-NHEt Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Amylin, amide, human Biological activity Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent. Molecular Weight 3903.28 Formula Formula C165H261N51O55S2 CAS Number 122384-88-7 Appearance…
Product Name Adropin (34-76) (human, mouse, rat) Biological activity Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway. Molecular Weight 4499.82 Formula Formula C190H293N55O68S2 CAS Number 1802086-30-1 Appearance…
Product Name Biotinyl-Glucagon (1-29), human, bovine, porcine Biological activity Biotinyl-Glucagon (1-29), human, bovine, porcine is a biotinylated glucagon. Glucagon is a peptide hormone, produced by α-cells of the pancreas, can increase concentration of glucose and fatty acids in the bloodstream. Sequence Shortening Sequence Shortening Biotinyl-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT Storage Please store the product under the recommended conditions in…
Product Name [8-L-arginine] deaminovasopressin Biological activity deaminovasopressin (dAVP) is a vasopressin analog. CAS Number 25255-33-8 Appearance Solid Color White to off-white Sequence Sequence Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly (Disulfide bridge:Cys1-Cys6) Sequence Shortening Sequence Shortening CYFQNCPRG(Disulfide bridge:Cys1-Cys6) Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed…
Product Name Human PTH-(1-31) amide Biological activity Human PTH-(1-31) amide is a PTH analog. Human PTH-(1-31) amide stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release. CAS Number 173833-08-4 Sequence Sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-NH2 Sequence Shortening Sequence Shortening SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name pTH (2-34) (human) Biological activity pTH (2-34) (human) (80 ??g/kg) slightly increases serum osteocalcin levels and alkaline phosphatase activity of bone extract (markers of bone formation) in mice. pTH (2-34) is not as effective as pTH (1-34). CAS Number 247902-18-7 Sequence Sequence Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe Sequence Shortening Sequence Shortening VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Storage Please store the product…
Product Name human GIP(3-30), amide TFA Biological activity Human GIP(3-30), amide TFA is the TFA salt form of human GIP(3-30), amide (HY-P10138). Human GIP(3-30), amide TFA is a high affinity antagonist of the human GIP receptor in vitro. Human GIP(3-30), amide TFA has potential anti-obesity and anti-diabetic effects. Formula Formula C150H226N38O44S.xC2HF3O2 Appearance Solid Color White…
Product Name Uroguanylin-15 (Rat) Biological activity Uroguanylin-15 (Rat) is a biological active peptide. (Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine…
Product Name Orexin A (1-15) free acid Biological activity Orexin A (1-15) (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us