Insert HTML here
Showing 449–464 of 883 results
Product Name Buccalin Biological activity Buccalin is a neuropeptide that colocalizes with small molecule cardioactive peptides in neuronal B15. When exogenously applied to the ARC neuromuscular junction, Buccalin reduces the amplitude of muscle contraction induced by motor neuron firing and acts only presynaptically. Buccalin has no effect on the rate of muscle relaxation and reduces…
Product Name Angiotensin I (human, mouse, rat) Biological activity Angiotensin I is a decapeptide hormone. Angiotensin I is the precursor of Angiotensin II (HY-13948). Angiotensin I can be used in the study of cardiovascular diseases such as hypertension and vasospasm. Molecular Weight 1296.48 Formula Formula C62H89N17O14 CAS Number 484-42-4 Appearance Solid Color White to off-white…
Product Name GLP-1(9-36)amide Biological activity GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor. Formula Formula C140H214N36O43 CAS Number 161748-29-4 Appearance Solid Color White to off-white Sequence Sequence Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence Shortening Sequence Shortening EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Storage Sealed storage,…
Product Name α-CGRP (mouse, rat) Biological activity α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the…
Product Name Insulin (swine) Biological activity Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin…
Product Name Pancreastatin Biological activity Pancreastatin is a biological active peptide. (Pancreastatin (PST) enhances hepatic glucose output leading to diabetes. ) CAS Number 113817-19-9 Appearance Solid Color White to off-white Sequence Sequence Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2 Sequence Shortening Sequence Shortening PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C,…
Product Name Urocortin III, mouse TFA Biological activity Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics. Appearance Solid Color White to…
Product Name Cortistatin-8 Biological activity Cortistatin-8 (CST-8; PCFWKTCK), a neuropeptide, is a GHS-R1a antagonist by counteracting the response of ghrelin on gastric acid secretion. Cortistatin-8 can modulate GH release from somatotroph cells. Cortistatin-8 is a synthetic CST-analogue devoid of any binding affinity to SST-R but capable to bind the GHS-R1a. Cortistatin-8 can exert antagonistic effects…
Product Name Zebrafish Kisspeptin-1 Biological activity Zebrafish Kisspeptin-1 is the core sequence of the neuropeptide kisspeptin-1, which participate in the regulation of gonadotropin-releasing hormone (GnRH) release, and regulates the reproductive system. CAS Number 1071873-79-4 Appearance Solid Color White to off-white Sequence Sequence Tyr-Asn-Leu-Asn-Ser-Phe-Gly-Leu-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YNLNSFGLRY-NH2 Storage Sealed storage, away from moisture Powder…
Product Name α-MSH TFA Biological activity α-MSH (α-Melanocyte-Stimulating Hormone) TFA, an endogenous neuropeptide, is an endogenous melanocortin receptor 4 (MC4R) agonist with anti-inflammatory and antipyretic activities. α-MSH TFA is a post-translational derivative of pro-opiomelanocortin (POMC). Formula Formula C77H109N21O19S.xC2HF3O2 CAS Number 171869-93-5 Appearance Solid Color White to off-white Sequence Sequence Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2 Sequence Shortening Sequence Shortening Ac-SYSMEHFRWGKPV-NH2
Product Name Somatostatin-14 (3-14) Biological activity Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 54518-51-3…
Product Name AtPep3 Biological activity AtPep3 is a hormone-like peptide. AtPep3 can enhance salinity tolerance of plants and inhibits the salt-induced bleaching of chlorophyll in seedlings. Formula Formula C102H178N36O32 CAS Number 902781-14-0 Sequence Shortening Sequence Shortening EIKARGKNKTKPTPSSGKGGKHN Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Delta (Phospho) Sleep Inducing Peptide Biological activity Delta (Phospho) Sleep Inducing Peptide (DSIP-P) is a long-lasting sleep-promoting peptide. Delta (Phospho) Sleep Inducing Peptide induces changes in the circadian locomotor behavior in rats. Molecular Weight 928.79 Formula Formula C35H49N10O18P CAS Number 70754-23-3 Appearance Solid Color White to off-white Sequence Sequence Trp-Ala-Gly-Gly-Asp-Ala-{Ser(PO3H2)}-Gly-Glu Sequence Shortening Sequence…
Product Name GLP-1(28-36)amide TFA Biological activity GLP-1(28-36)amide TFA, a C-terminal nonapeptide of GLP-1, is a major product derived from the cleavage of GLP-1 by the neutral endopeptidase (NEP). GLP-1(28-36)amide TFA is an antioxidant and targets to mitochondrion, inhibits mitochondrial permeability transition (MPT). GLP-1(28-36)amide TFA has anti-diabetic and cardioprotection effects. Molecular Weight 1202.37 Formula Formula C56H86F3N15O11…
Product Name Neurotensin Biological activity Neurotensin, a gut tridecapeptide, acts as a potent cellular mitogen for various colorectal and pancreatic cancers which possess high-affinity neurotensin receptors (NTR). Molecular Weight 1672.92 Formula Formula C78H121N21O20 CAS Number 39379-15-2 Appearance Solid Color White to off-white Sequence Sequence {Pyr}-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu
Product Name Octreotide acetate Biological activity Octreotide acetate, a long-acting synthetic analog of native somatostatin, inhibits growth hormone, glucagon, and insulin more potently. Molecular Weight 1079.29 Formula Formula C51H70N10O12S2 CAS Number 79517-01-4 Appearance Solid Color White to off-white Sequence Sequence {d-Phe}-Cys-Phe-{d-Trp}-Lys-Thr-{Cys(X)}-{Thr(deoxy)} (disulfide bridge: Cys2-Cys7) (X=N-(1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl) Sequence Shortening Sequence Shortening {d-Phe}-CF-{d-Trp}-KY-{Cys(X)}-{Thr(deoxy)} (disulfide bridge: Cys2-Cys7) (X=N-(1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl)
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us