Insert HTML here
Showing 465–480 of 883 results
Product Name Orexin A (human, rat, mouse) acetate Biological activity Orexin A (Hypocretin-1) (human, rat, mouse) acetate is a hypothalamic neuropeptide with analgesic properties (crosses the blood-brain barrier). Orexin A (human, rat, mouse) acetate binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human,…
Product Name Bradykinin Biological activity Bradykinin is an effective endothelium-dependent vasodilator that can lower blood pressure. Bradykinin can induce contraction of bronchial and intestinal non-vascular smooth muscle, increase vascular permeability, and participate in the mechanism of pain. Molecular Weight 1060.21 Formula Formula C50H73N15O11 CAS Number 58-82-2 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg
Product Name Amylin, amide, human TFA Biological activity Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent. Molecular Weight 4017.3 Formula Formula C167H262F3N51O57S2 Appearance…
Product Name β-CGRP, human Biological activity β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells. Molecular Weight 3793.41 Formula Formula C162H267N51O48S3 CAS Number 101462-82-2 Appearance Solid Color White to…
Product Name Gastrin I, rat Biological activity Gastrin I, rat (Rat Gastrin-17) is a peptide hormone, can stimulate gastric acid secretion potently. CAS Number 81123-06-0 Appearance Solid Color White to off-white Sequence Sequence {Pyr}-Arg-Pro-Pro-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening Sequence Shortening {Pyr}-RPPMEEEEEAYGWMDF-NH2 Storage Sealed storage, away from moisture and light, under nitrogen Powder -80??C 2 years -20??C 1…
Product Name Gastric Inhibitory Polypeptide (6-30) amide (human) Biological activity Gastric Inhibitory Polypeptide (6-30) amide (human) is an incretin hormone. Gastric Inhibitory Polypeptide (6-30) amide (human) can be used for the research of diabete. CAS Number 1139691-72-7 Sequence Sequence Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 Sequence Shortening Sequence Shortening FISDYSIAMDKIHQQDFVNWLLAQK-NH2 Storage Please store the product under the recommended conditions in…
Product Name Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse Biological activity Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner. Molecular Weight 3062.41 Formula Formula C128H205N45O39S2 CAS Number 88898-17-3 Appearance Solid Color White to off-white Sequence…
Product Name Urotensin I TFA Biological activity Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β…
Product Name Substance P, FAM-labeled Biological activity Substance P, FAM-labeled is a FAM labeled Substance P (HY-P0201). Sequence Sequence FAM-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 Sequence Shortening Sequence Shortening FAM-RPKPQQFFGLM-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name GLP-2(rat) (Ala-13C3,15N) Biological activity GLP-2(rat) (Ala-13C3,15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Molecular Weight 3800.11 Formula Formula C16313C3H256N4315NO56S Sequence Sequence His-{Ala-13C3,15N}-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp Sequence Shortening…
Product Name Neuropeptide Y, porcine Biological activity Neuropeptide Y, porcine, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion. CAS Number 83589-17-7 Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Substance P Biological activity Substance P (Neurokinin P) is a CNS-penetrant neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R). Molecular Weight 1347.63 Formula Formula C63H98N18O13S CAS Number 33507-63-0 Appearance Solid Color White to off-white Sequence Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2
Product Name Neuropeptide Y (human,rat,mouse) Biological activity Neuropeptide Y (human,rat,mouse) is involved in Alzheimer’s disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. Formula Formula C189H285N55O57S CAS Number 90880-35-6 Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence Shortening Sequence Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 Storage Sealed storage, away from moisture and light Powder -80??C 2…
Product Name Systemin Biological activity Systemin, an 18-amino acid polypeptide, has been isolated from tomato leaves that is a powerful inducer of over 15 defensive genes. Formula Formula C85H144N26O28S CAS Number 137181-56-7 Appearance Solid Color White to off-white Sequence Sequence Ala-Val-Gln-Ser-Lys-Pro-Pro-Ser-Lys-Arg-Asp-Pro-Pro-Lys-Met-Gln-Thr-Asp Sequence Shortening Sequence Shortening AVQSKPPSKRDPPKMQTD
Product Name β-Casomorphin, bovine Biological activity β-Casomorphin, bovine (β-Casomorphin-7 (bovine) ) is a opioid peptide with an IC50 of 14 ??M in an Opioid receptors binding assay. Molecular Weight 789.92 Formula Formula C41H55N7O9 CAS Number 72122-62-4 Appearance Solid Color White to off-white Sequence Sequence Tyr-Pro-Phe-Pro-Gly-Pro-Ile Sequence Shortening Sequence Shortening YPFPGPI
Product Name α-Neoendorphin (1-8) Biological activity α-Neoendorphin (1-8) is a 8-amino acid peptide derived from the N-terminal of α-Neoendorphin. α-Neoendorphin is an endogenous opioid peptide. CAS Number 83339-89-3 Sequence Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr Sequence Shortening Sequence Shortening YGGFLRKY Storage Please store the product under the recommended conditions in the Certificate of Analysis.
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Neuropeptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us