Neuropeptides

Product Name AGA-(C8R) HNG17, humanin derivative TFA Biological activity AGA-(C8R) HNG17, humanin derivative TFA is a potent humanin (HN) derivative. AGA-(C8R) HNG17, humanin derivative completely suppresses neuronal cell death by Alzheimer’s disease-relevant insults. Appearance Solid Color White to off-white Sequence Sequence Pro-Ala-Gly-Ala-Ser-Arg-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro Sequence Shortening Sequence Shortening PAGASRLLLLTGEIDLP Storage Sealed storage, away from moisture Powder -80??C…

Product Name pTH (44-68) (human) TFA Biological activity pTH (44-68) (human) TFA is a fragment of human parathyroid hormone (pTH) that lacks the adenylate cyclase-stimulating activity of intact pTH. pTH (44-68) (human) TFA can be used to study the mechanism of action of pTH. Appearance Solid Color White to off-white Sequence Sequence Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly Sequence Shortening…

Product Name BNP(1-32), porcine Biological activity BNP(1-32), porcine (pBNP-32) is a cardiac hormone. BNP(1-32), porcine is an atrial natriuretic peptide, which exhibits natriuretic, diuretic and vasorelaxant effects. BNP(1-32), porcine affects passive avoidance learning in rats with dopaminergic, cholinergic, α-and β-adrenergic mediation. CAS Number 117345-87-6 Sequence Sequence Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge: Cys10-Cys26) Sequence Shortening Sequence Shortening SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY…

Product Name [Ala3,11,18, Nle7] Endothelin-1, human Biological activity Endothelin-1, human is a synthetic peptide. Sequence Shortening Sequence Shortening CSASSL-{Nle}-DKEAVYFCHLAIIW Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name Adipokinetic hormone (Gryllus bimaculatus) Biological activity Adipokinetic hormone Gryllus bimaculatus (Grybi-AKH) is an adipokinetic hormone that regulates energy homeostasis in insects by mobilizing lipid and carbohydrate from the fat body. Adipokinetic hormone Gryllus bimaculatus stimulates the locomotor activity of the two-spotted cricket. Adipokinetic hormone Gryllus bimaculatus can also be used in studies to…

Product Name [Tyr(P)4] Biological activity Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels. CAS Number 129785-85-9 Sequence Shortening Sequence Shortening DRV-{pTyr}-IHPF Storage Please store the product under the recommended conditions in the Certificate of Analysis.

Product Name GIP (3-42), human Biological activity GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo. Molecular Weight 4749.4 Formula Formula C214H324N58O63S CAS Number 1802086-25-4 Appearance Solid Color White to off-white Sequence Sequence Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln Sequence Shortening Sequence Shortening EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Product Name pTH (44-68) (human) Biological activity pTH (44-68) (human) is apTH ((Human parathyroid hormone) fragment. CAS Number 64421-69-8 Sequence Sequence Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly Sequence Shortening Sequence Shortening RDAGSQRPRKKEDNVLVESHEKSLG Storage Please store the product under the recommended conditions in the Certificate of Analysis.