Insert HTML here
Showing 257–272 of 667 results
Gageotetrin A is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin A has antifungal activity but is non-toxic to many human cancer cells. Product Details Product Name Gageotetrin A Biological activity Gageotetrin A is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin A has antifungal activity, but none toxic…
Gageotetrin B has antibacterial activity. Compared with bacteria, Gageotetrin B has stronger inhibitory activity against fungi, with MIC values of 0.01-0.04 ??M. Product Details Product Name Gageotetrin B Biological activity Gageotetrin B has antimicrobial activities. Gageotetrin B is more active against fungi compared to bacteria with MIC values of 0.01-0.04 ??M. Sequence {HTDA}-{Glu(OMe)}-Leu-Leu-Leu Sequence Shortening…
Gageotetrin C is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin C is more active against fungi (MIC values of 0.02-0.04 ??M). Product Details Product Name Gageotetrin C Biological activity Gageotetrin C is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin C is more active against fungi (MIC value…
Gallin is an antimicrobial peptide derived from egg white. Gallin inhibits the growth of Escherichia coli at a concentration of 0.25 ??M. Product Details Product Name Gallin Biological activity Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 ??M concentration. Sequence Shortening LVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK (Disulfide bridge:Cys4-Cys10;Cys5-Cys18) Storage…
Garvicin KS, GakA is a peptide composed of 34 amino acids that forms the bacteriocin Garvicin KS (GarKS) together with 2 other peptides, GakB and GakC. Garvicin KS, GakA inhibits fibroblast viability and proliferation. Garvicin KS (GakA with GakB) is an effective combination with good peptide stability, antibacterial efficacy, and fibroblast viability/proliferation effects. The Garvicin…
Garvicin KS, GakB is a peptide composed of 34 amino acids that forms the bacteriocin Garvicin KS (GarKS) together with 2 other peptides, GakA and GakC. Garvicin KS, GakB inhibits fibroblast viability and proliferation. Garvicin KS (GakB with GakA) is an effective combination with good peptide stability, antibacterial efficacy, and fibroblast viability/proliferation effects. The Garvicin…
Garvicin KS, GakC is a peptide composed of 32 amino acids that forms the bacteriocin Garvicin KS (GarKS) together with 2 other peptides, GakA and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. The Garvicin KS peptides inhibit MSSA, with the MIC value order GakB > GakC > GakA. Product Details Product Name Garvicin…
GE 2270A (MDL 62879) is an antibiotic. GE 2270A inhibits Gram-positive bacteria and anaerobes by inhibiting protein synthesis. GE 2270A can be used in infection research. Product Details Product Name GE 2270A Biological activity GE 2270A (MDL 62879) is an antibiotic. GE 2270A inhibits gram-positive bacteria and anaerobes by inhibiting protein synthesis. GE 2270A can…
GF-17 is a polypeptide containing 17 amino acids. GF-17 is the precursor peptide of GF19. GF-17 has significant antiviral activity. GF-17 can be used in research on viral infections, such as HSV-1. Product Details Product Name GF-17 Biological activity GF-17 is a polypeptide containing 17 amino acids. is the precursor peptide of GF19. GF-17 exhibits…
GLK-19 is an antimicrobial peptide with anti-E. coli activity (MIC: 10 ??M). Product Details Product Name GLK-19 Biological activity GLK-19 is an antimicrobial peptide, and is active against E. coli (MIC: 10 ??M). CAS Number 1225014-04-9 Sequence Gly-Leu-Lys-Lys-Leu-Leu-Gly-Lys-Leu-Leu-Lys-Lys-Leu-Gly-Lys-Leu-Leu-Leu-Lys Sequence Shortening GLKKLLGKLLKKLGKLLLK Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Globomycin is a lipopeptide antibiotic and an inhibitor of signal peptidase II (LspA). Globomycin inhibits prolipoprotein processing by irreversibly binding to the peptidase. Globomycin is toxic to Spiroplasma melliferum, with MIC values in the range of 6.25-12.5 ??M. Product Details Product Name Globomycin Biological activity Globomycin is a lipopeptide antibiotic and a signal peptidase II…
Globomycin derivative G2A (Compound G2A) is an inhibitor of lipoprotein signal peptidase II (LspA) with an IC50 of 604 nM. Globomycin derivative G2A inhibits E. coli, P. aeruginosa, and A. baumannii, with MIC values ranging from 12.5 to 32 ??g/mL. Product Details Product Name Globomycin derivative G2A Biological activity Globomycin derivative G2A (Compound G2A) is…
GLR-19 is an anti-HIV peptide. GLR-19 also has antiviral activity against HSV-2. Product Details Product Name GLR-19 Biological activity GLR-19 is an anti-HIV peptide. GLR-19 also has antiviral activity against HSV-2. Sequence Gly-Leu-Arg-Arg-Leu-Leu-Gly-Arg-Leu-Leu-Arg-Arg-Leu-Gly-Arg-Leu-Leu-Leu-Arg Sequence Shortening GLRRLLGRLLRRLGRLLLR Storage Please store the product under the recommended conditions in the Certificate of Analysis.
GMPRGA is derived from bacteriophage Spbeta and can recognize spAimR in the bacterial cytoplasm to promote lysogeny. Product Details Product Name GMPRGA Biological activity GMPRGA, derived from the phages Spbeta, can recognize spAimR in the bacterial cytosol to induce lysogeny. Appearance Solid Color White to off-white Sequence Gly-Met-Pro-Arg-Gly-Ala Sequence Shortening GMPRGA Storage Please store the…
GMPRGA (TFA) is the TFA salt form of GMPRGA (HY-P6011). GMPRGA (TFA) can recognize spAimR in the bacterial cytoplasm to promote lysogeny. Product Details Product Name GMPRGA TFA Biological activity GMPRGA (TFA) is the TFA form of GMPRGA (HY-P6011). GMPRGA (TFA) can recognize spAimR in the bacterial cytosol to induce lysogeny. Color White to off-white…
Golotimod (SCV 07) is an immunomodulatory peptide with antibacterial activity that significantly improves the efficacy of anti-tuberculosis research, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models receiving radiotherapy or radiotherapy combined with cisplatin. Golotimod has potential for…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Antimicrobial Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us