Defensin HNP-2 human is an endogenous antibiotic peptide produced by human neutrophils and a monocyte chemoattractant peptide. Product Details Product Name Defensin HNP-2 human Biological activity Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils. Sequence Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys1-Cys29,Cys3-Cys18,Cys8-Cys28) Sequence Shortening CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys1-Cys29,Cys3-Cys18,Cys8-Cys28) Storage Please store the…
Defensin HNP-3 human is an ??-defensin stored in the azurophilic granules of human neutrophils. Defensin HNP-3 human exerts broad-spectrum bactericidal, antifungal, and antiviral activities mainly by forming pores in bacterial membranes, and acts as a chemoattractant for monocytes and T cells. Defensin HNP-3 human supports periodontal tissue homeostasis by maintaining epithelial integrity and exerts concentration-dependent…
Defensin NP-3A (NP-3A; Corticostatin 1) is a human granulocyte peptide with anti-ACTH activity. Defensins are antimicrobial peptides with killing activity. Product Details Product Name Defensin NP-3A Biological activity Defensin NP-3A (NP-3A; Corticostatin 1) is a human granulocyte peptide, with anti-ACTH activity. Defensins are antimicrobial peptides with and cytotoxic activity. Sequence Gly-Ile-Cys-Ala-Cys-Arg-Arg-Arg-Phe-Cys-Pro-Asn-Ser-Glu-Arg-Phe-Ser-Gly-Tyr-Cys-Arg-Val-Asn-Gly-Ala-Arg-Tyr-Val-Arg-Cys-Cys-Ser-Arg-Arg (disulfide bridge:Cys3-Cys31,Cys5-Cys20,Cys10-Cys30) Sequence Shortening…
Delta-hemolysin (Delta-lysin) is a 26-amino-acid peptide and a hemolytic peptide produced by staphylococci. Delta-hemolysin may slightly interfere with cell membranes or cause cell lysis. Delta-hemolysin is a model for studying peptide-membrane interactions. Delta-hemolysin has weak activity against bacteria. Product Details Product Name Delta-hemolysin Biological activity Delta-hemolysin (Delta-lysin), a 26 amino acid peptide, is a hemolytic…
Delta-hemolysin (Delta-lysin) TFA is a 26-amino-acid peptide and a hemolytic peptide produced by staphylococci. Delta-hemolysin TFA may slightly interfere with cell membranes or cause cell lysis. Delta-hemolysin TFA is a model for studying peptide-membrane interactions. Delta-hemolysin TFA has weak activity against bacteria. Product Details Product Name Delta-hemolysin TFA Biological activity Delta-hemolysin (Delta-lysin) TFA, a 26…
Dermaseptin is a polypeptide isolated from frog skin that exhibits potent antimicrobial activity against bacteria, fungi, and protozoa. Product Details Product Name Dermaseptin Biological activity Dermaseptin, a peptide isolated from frog skin, exhibits potent antimicrobial activity against?bacteria,?fungi, and protozoa?at micromolar concentration. CAS Number 136212-91-4 Appearance Solid Color White to off-white Sequence Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence Shortening ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ
Dermaseptin TFA is a peptide isolated from frog skin that exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentrations. Product Details Product Name Dermaseptin TFA Biological activity Dermaseptin TFA, a peptide isolated from frog skin, exhibits potent antimicrobial activity against?bacteria,?fungi, and?protozoa?at micromolar concentration. Appearance Solid Color White to off-white Sequence Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence…
Dermaseptin-B3 inhibits the growth of Gram-positive and Gram-negative bacteria (with MICs of 1.3, 2.3, 5.0, 2.6, and 2.3 ??M against S. aureus, P. aeruginosa, P. aeruginosa, E. coli (ATCC 25922), and E. coli (54127), respectively). Dermaseptin-B3 also inhibits tumor cell proliferation. Product Details Product Name Dermaseptin-B3 Biological activity Dermaseptin-B3 inhibits the growth of Gram-positive and…
Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Product Details Product Name Dermaseptin-B4 Biological activity Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Sequence Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-Leu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser-NH2 Sequence Shortening ALWKDILKNVGKAAGKAVLNTVTDMVNQ-NH2 Storage Please store the product under the recommended conditions…
Dermaseptin-B5 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Product Details Product Name Dermaseptin-B5 Biological activity Dermaseptin-B5 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor. Sequence Gly-Leu-Trp-Asn-Lys-Ile-Lys-Glu-Ala-Ala-Ser-Lys-Ala-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Phe-Val-Asn-Glu-Met-Val-NH2 Sequence Shortening GLWNKIKEAASKAAGKAALGFVNEMV-NH2 Storage Please store the product under the recommended conditions…
Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the subfamily Phyllomedusinae. Product Details Product Name Dermaseptin-B9 Biological activity Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the Phyllomedusinae subfamily. Sequence Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-Leu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser Sequence Shortening ALWKTIIKGAGKMIGSLAKNLLGSQAQPES Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S1 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S1 Biological activity Dermaseptin-S1 is an antimicrobial peptide derived from frog skin against filamentous fungi. Appearance Solid Color White to off-white Sequence Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence Shortening ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ Storage Sealed storage, away from moisture
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S2 Biological activity Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Ala-Leu-Trp-Phe-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asn-Thr-Ile-Ser-Gln-Gly-Thr-Gln Sequence Shortening ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S3 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S3 Biological activity Dermaseptin-S3 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Ala-Leu-Trp-Lys-Asn-Met-Leu-Lys-Gly-Ile-Gly-Lys-Leu-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Val-Lys-Lys-Leu-Val-Gly-Ala-Glu-Ser Sequence Shortening ALWKNMLKGIGKLAGKAALGAVKKLVGAES Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S4 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S4 Biological activity Dermaseptin-S4 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Ala-Leu-Trp-Met-Thr-Leu-Leu-Lys-Lys-Val-Leu-Lys-Ala-Ala-Ala-Lys-Ala-Ala-Leu-Asn-Ala-Val-Leu-Val-Gly-Ala-Asn-Ala Sequence Shortening ALWMTLLKKVLKAAAKAALNAVLVGANA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Dermaseptin-S5 is an antimicrobial peptide derived from frog skin with anti-filamentous fungal activity. Product Details Product Name Dermaseptin-S5 Biological activity Dermaseptin-S5 is an antimicrobial peptide derived from frog skin against filamentous fungi. Sequence Gly-Leu-Trp-Ser-Lys-Ile-Lys-Thr-Ala-Gly-Lys-Ser-Val-Ala-Lys-Ala-Ala-Ala-Lys-Ala-Ala-Val-Lys-Ala-Val-Thr-Asn-Ala-Val Sequence Shortening GLWSKIKTAGKSVAKAAAKAAVKAVTNAV Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
