Garvicin KS, GakC
Description
Garvicin KS, GakC is a peptide composed of 32 amino acids that forms the bacteriocin Garvicin KS (GarKS) together with 2 other peptides, GakA and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. The Garvicin KS peptides inhibit MSSA, with the MIC value order GakB > GakC > GakA.
Product Details
| Product Name | Garvicin KS, GakC |
| Biological activity | Garvicin KS, GakC is a peptide at sizes of 32 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA. |
| Sequence | Met-Gly-Ala-Ile-Ile-Lys-Ala-Gly-Ala-Lys-Ile-Val-Gly-Lys-Gly-Ala-Leu-Thr-Gly-Gly-Gly-Val-Trp-Leu-Ala-Glu-Lys-Leu-Phe-Gly-Gly-Lys |
| Sequence Shortening | MGAIIKAGAKIVGKGALTGGGVWLAEKLFGGK |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
