OFFICIAL STATEMENT-Regarding Fraudulent Websites

store

  • Escherichia coli Beta-galactosidase 2 877-885, TPHPARIGL

    Escherichia coli Beta-galactosidase 2 877-885, TPHPARIGL

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Escherichia coli Protein Name: Beta-galactosidase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-TPHPARIGL-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Esculentin 1A

    Esculentin 1A

    Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity. Product Details Product Name Esculentin 1A Biological activity Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity. Appearance Solid Color White to off-white Sequence Shortening GIFSKLAGKKIKNLLISGLKNVGKEVGMDVVRTGIDIAGCKIKGEC (Disulfide bridge: Cys40-Cys46) Storage Sealed storage, away from…

    Read moreDone
  • Etimumotide

    Etimumotide

    Etimumotide is an immunological agent for active immunization, as well as an antineoplastic agent. Product Information Product Name Etimumotide Molecular Weight 2296.68 Formula C111H162N24O27S CAS Number 1431550-68-3 Sequence Phe-Met-Thr-Tyr-Trp-His-Leu-Leu-Asn-Ala-Phe-Thr-Val-Thr-Val-Pro-Lys-Asp-Leu Sequence Shortening FMTYWHLLNAFTVTVPKDL

    Read moreDone
  • ETTAC-2

    ETTAC-2

    ETTAC-2 is a LRG1 PROTAC degrader, degrading LRG1 via the ubiquitin-proteasome pathway with a DC50 value of 8.38 ??M. ETTAC-2 penetrates damaged renal cells to reduce the extracellular secretion of LRG1. ETTAC-2 effectively inhibits the TGF-β-Smad3 signaling pathway and diminishes the secretion of fibrosis-associated extracellular matrix proteins. ETTAC-2 degrades LRG1 within fibrotic kidneys and the…

    Read moreDone
  • Eumenitin

    Eumenitin

    Eumenitin is an antibacterial peptide with strong membrane activity, broad-spectrum antibacterial activity, and almost no hemolytic toxicity. Eumenitin has inhibitory effects against a variety of Gram-positive and Gram-negative bacteria. Eumenitin induces ??-hexosaminidase release from rat peritoneal mast cells and RBL-2H3 cells. Eumenitin can be used in research on infectious diseases. Product Details Product Name Eumenitin…

    Read moreDone
  • Excitin 1

    Excitin 1

    Excitin 1 is an orally active and CNS-penetrated peptide, alters behavior and brain monoamine and amino acid concentrations in rats. Product Information Product Name Excitin 1 Molecular Weight 202.25 Formula C9H18N2O3 CAS Number 17136-25-3

    Read moreDone
  • Exendin-4 (CAS: 141758-74-9)

    Exendin-4 (CAS: 141758-74-9)

    Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Heloderma suspectum Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

    Read moreDone
  • Exendin-4 acetate

    Exendin-4 acetate

    Exendin-4 acetate (Exenatide acetate) is an orally active, blood-brain barrier-permeable glucagon-like peptide-1 receptor (GLP?1 receptor) agonist that resists degradation mediated by dipeptidyl peptidase IV. Exendin-4 acetate mediates multiple glucose-regulating effects, including stimulation of glucose-dependent insulin secretion, inhibition of glucagon production, increase in β-cell mass, delay of gastric emptying, reduction of food intake, improvement of peripheral…

    Read moreDone
  • Exendin(9-39) amide

    Exendin(9-39) amide

    Exendin (9-39) amide (Avexitide) is a competitive GLP-1R antagonist. Exendin (9-39) amide blocks the Semaglutide (HY-114118)-induced increase in insulin secretion and also attenuates the hypoglycemic effect of Semaglutide. Exendin (9-39) amide abolishes the islet-protective effect of Liraglutide. Exendin (9-39) amide can be used in research on type 2 diabetes and type 1 diabetes. Product Information…

    Read moreDone
  • Exendin(9-39) amide acetate

    Exendin(9-39) amide acetate

    Exendin (9-39) amide acetate (Avexitide acetate) is a competitive GLP-1R antagonist. Exendin (9-39) amide acetate blocks the Semaglutide (HY-114118)-induced increase in insulin secretion and also attenuates the hypoglycemic effect of Semaglutide. Exendin (9-39) amide acetate abolishes the islet-protective effect of Liraglutide. Exendin (9-39) amide acetate can be used in research on type 2 diabetes and…

    Read moreDone
  • Extracellular death factor

    Extracellular death factor

    Extracellular death factor (EDF) is the only single signaling molecule involved in Escherichia coli quorum sensing that can initiate mazEF-mediated cell death. Extracellular death factor significantly enhances the ribonuclease activity of MazF and ChpBK. Product Details Product Name Extracellular death factor Biological activity Extracellular death factor (EDF) is the only single signaling molecule involved in…

    Read moreDone
  • Ezatiostat

    Ezatiostat

    Ezatiostat (TER199 free base; TLK199) is a tripeptide analog of glutathione and is a selective and orally active glutathione S-transferase P1-1 (GSTP1) inhibitor. Ezatiostat leads to JNK activation by inhibiting GSTP1. Ezatiostat stimulates both lymphocyte production and bone marrow progenitor proliferation. Ezatiostat has the potential for myelodysplastic syndrome (MDS) treatment. Product Information Product Name Ezatiostat…

    Read moreDone
  • Ezatiostat hydrochloride

    Ezatiostat hydrochloride

    Ezatiostat hydrochloride (TER199; TLK199 hydrochloride) is a tripeptide analog of glutathione and is a selective and orally active glutathione S-transferase P1-1 (GSTP1) inhibitor. Ezatiostat hydrochloride leads to JNK activation by inhibiting GSTP1. Ezatiostat hydrochloride stimulates both lymphocyte production and bone marrow progenitor proliferation. Ezatiostat hydrochloride has the potential for myelodysplastic syndrome (MDS) treatment. Product Information…

    Read moreDone
  • F4-Trp

    F4-Trp

    Product Name HAEGTFTSD Biological activity HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner Formula Formula C40H57N11O17 CAS Number 926018-45-3 Appearance Solid Color White to off-white Sequence Shortening Sequence Shortening HAEGTFTSD Storage Sealed storage, away from moisture…

    Read moreDone
  • FC382K10W15

    FC382K10W15

    Product Name PACAP (1-38) free acid TFA Biological activity PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also…

    Read moreDone
  • FC382K10W15 TFA

    FC382K10W15 TFA

    Product Name FC382K10W15 Biological activity FC382K10W15 is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 can be used in type 2 diabetes research. Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-{Lys(octadecanedioic acid monoacyl-γGlu-2xOEG)}-Ser-Lys-Tyr-Leu-Asp-Ser-Gln-Ala-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser Sequence Shortening Sequence Shortening HSQGTFTSD-{Lys(octadecanedioic acid monoacyl-γGlu-2xOEG)}-SKYLDSQAAQDFVQWLMNGGPSSGAPP Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone