Insert HTML here
Showing 785–800 of 3705 results
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: N-terminally biotinylated synthetic Beta-Amyloid peptide (1-42)
Product Name Biotinyl-BNP-32 (human) Biological activity Biotinyl-BNP-32 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1816258-27-1…
Product Name Neuropeptide SF (human) Biological activity Neuropeptide SF human augments paraventricular corticotrophin-releasing hormone (CRH) release and increases adrenocorticotropic hormone (ACTH) and corticosterone levels in the plasma. Neuropeptide SF human play a physiologic role in the regulation of such circadian functions as the activity of motor centers and the HPA axis, through the release of…
Product Name A8SGLP-1 Biological activity A8SGLP-1 is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 reduces blood glucose in db/db mice without affecting its function. CAS Number 753024-08-7 Sequence Sequence His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-NH2 Sequence Shortening Sequence Shortening HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 Storage Please store the product under the recommended conditions in the Certificate…
Product Name Goserelin Biological activity Goserelin (ICI 118630), a decapeptide analogue of gonadotropin-releasing hormone (GnRH/LHRH), functions as a GnRH agonist. Goserelin can be used for the research of breast cancer, epithelial ovarian cancer and prostate cancer. Molecular Weight 1269.41 Formula Formula C59H84N18O14 CAS Number 65807-02-5 Sequence Sequence {Glp}-His-Trp-Ser-Tyr-Ser(OtBu)-Leu-Arg-Pro-{Hydrazinecarboxamide} Sequence Shortening Sequence Shortening {Glp}-HWSY-Ser(OtBu)-LRP-{Hydrazinecarboxamide}
Product Name Xenin Biological activity Xenin is a 25-amino acid peptide initially isolated from human gastric mucosa. Xenin is a gut hormone that can reduce food intake. Molecular Weight 2971.57 Formula Formula C139H224N38O32S CAS Number 144092-28-4 Appearance Solid Color White to off-white Sequence Sequence Met-Leu-Thr-Lys-Phe-Glu-Thr-Lys-Ser-Ala-Arg-Val-Lys-Gly-Leu-Ser-Phe-His-Pro-Lys-Arg-Pro-Trp-Ile-Leu Sequence Shortening Sequence Shortening MLTKFETKSARVKGLSFHPKRPWIL
Product Name β-MSH (monkey) Biological activity β-MSH (monkey) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 17750-75-3…
Product Name Cockroach Myoactive Peptide I Biological activity Cockroach Myoactive Peptide I (Pea-CAH-I) is a cockroach neuropeptide, a member of the adipokinetic hormone/red pigment-concentrating hormone family (AKH/RPCH family). CAS Number 93208-51-6 Sequence Shortening Sequence Shortening {Glp}-VNFSPNW-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Biotinyl-KR-12 (human) is a polypeptide that can be discovered by peptide screening. Peptide screening is a research tool that primarily collects active peptides through immunoassays. Peptide screening can be used in protein interaction, functional analysis, and antigen epitope screening, especially in the field of active molecule research and development. Product Details Product Name Biotinyl-KR-12 (human)…
Biotinyl-LL-37 is a polypeptide that can be discovered by peptide screening. Peptide screening is a research tool that primarily collects active peptides through immunoassays. Peptide screening can be used in protein interaction, functional analysis, and antigen epitope screening, especially in the field of active molecule research and development. Product Details Product Name Biotinyl-LL-37 Biological activity…
Product Name sGnRH-A acetate Biological activity sGnRH-A acetate is a salmon gonadotropin-releasing hormone (GnRH) analogue. sGnRH-A acetate stimulates growth hormone secretion. sGnRH-A acetate also can be used as an inducer of ovulation by artificial insemination. Formula Formula C64H83N17O12??xC2H4O2 Appearance Solid Color White to off-white Sequence Sequence {pGlu}-His-Trp-Ser-Tyr-{d-Arg}-Trp-Leu-Pro-NHEt Sequence Shortening Sequence Shortening {pGlu}-HWSY-{d-Arg}-WLP-NHEt Storage Sealed storage,…
Product Name GHRF, mouse Biological activity GHRF, mouse, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse stimulates the release and synthesis of growth hormone. Formula Formula C220H365N69O64S CAS Number 125199-49-7 Sequence Sequence His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser Sequence Shortening Sequence Shortening HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS Storage Please store the product under the recommended conditions in the…
Product Name Biotinyl-α-CGRP (human) Biological activity Biotinyl-α-CGRP (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 1816258-60-2…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Melanoma Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Baculoviral IAP repeat-containing protein (BIRC) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-QLCPICRAPV-OH Specifications: 10mer peptide as TFA salt
Bivalirudin, a hirudin analog and anticoagulant, is a direct thrombin inhibitor. Bivalirudin inhibits thrombin-mediated fibrinogen cleavage, coagulation factor activation, and platelet activation by reversibly binding to thrombin. In addition, Bivalirudin also has certain effects of anti-virus, anti-inflammation, and vascular endothelial barrier function protection. Bivalirudin can be used for the research of thrombotic diseases and others….
Bivalirudin TFA, a hirudin analog and anticoagulant, is a direct thrombin inhibitor. Bivalirudin TFA inhibits thrombin-mediated fibrinogen cleavage, coagulation factor activation, and platelet activation by reversibly binding to thrombin. In addition, Bivalirudin TFA also has certain effects of anti-virus, anti-inflammation, and vascular endothelial barrier function protection. Bivalirudin TFA can be used for the research of…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us