Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection Layout: Freeze-dried in glass vial Organism: Human T-cell leukemia virus (HTLV-1) Protein Name: Tax-1 Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence:…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Human Protein Name: Actin Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification:…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Alpha-fetoprotein Purity: >70% (HPLC-MS), Development Grade: each peptide purified to >…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Alzheimer’s disease, Neurodegeneration Layout: Freeze-dried in glass vial Organism: Human Protein Name: Alpha-Synuclein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Specifications:…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Brachyury Mutation, Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Transcription factors/activators Purity: >70% (HPLC-MS), Development Grade: each peptide…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Serine/threonine-protein kinase B-raf Purity: >70% (HPLC-MS), Development Grade: each peptide purified…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Blood coagulation Layout: Freeze-dried in glass vial Organism: Human Protein Name: Coagulation factor VIII Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: F5/8…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Blood coagulation Layout: Freeze-dried in glass vial Organism: Human Protein Name: Coagulation factor VIII Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: F5/8…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager