Insert HTML here
Showing 753–768 of 3705 results
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA Specifications: Synthetic Beta-Amyloid peptide (1-42)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-Lys(Biotin)- Specifications: C-terminally biotinylated synthetic Beta-Amyloid peptide (1-42)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT Specifications: Synthetic Beta-Amyloid peptide (1-43)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: LVFFAEDVGSNKGAIIGLMVGGVV Specifications: Synthetic Beta-Amyloid peptide (17-40)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: LVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: Synthetic Beta-Amyloid peptide (17-42)
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in a variety of organisms and is involved in the first line of defense of innate immunity. Product Details Product Name Beta-defensin 103 isoform X1, pig Biological activity Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the…
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in a variety of organisms and is involved in the first line of defense of innate immunity. Product Details Product Name Beta-defensin 103 isoform X1, pig TFA Biological activity Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms,…
Product Name Atriopeptin I (rat, mouse) Biological activity Atriopeptin I rat, mouse is an atrial natriuretic peptide, which stimulates the testosterone production with half-maximum stimulation of 38 nM. CAS Number 89139-53-7 Sequence Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser (Disulfide bridge: Cys3-Cys19) Sequence Shortening Sequence Shortening SSCFGGRIDRIGAQSGLGCNS (Disulfide bridge: Cys3-Cys19) Storage Please store the product under the recommended conditions in…
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Microcebus murinus Protein Name: Bevacizumab Purity: >90% (HPLC-MS) Quantification: No Sequence: H-STAYLQMNSLR-OH Specifications: 11mer cancer peptide
Bibapcitide, a 26 amino acid, inhibits thrombosis. Product Information Product Name Bibapcitide Molecular Weight 3021.35 Formula C112H162N36O43S10 CAS Number 153507-46-1 Sequence Chain 1:{Maa}-{D-Tyr}-Cys-Gly-Asp-Cys-Gly-Gly-Cys-Gly-Cys-Gly-Gly-Cys (Carba sulfide bridge:Maa1-Cys6); Chain 2:{Maa}-{D-Tyr}-Cys-Gly-Asp-Cys-Gly-Gly-Cys-Gly-Cys-Gly-Gly-Cys(Carba sulfide bridge:Maa1-Cys6) (Covalent bridge:Chain1 Cys6-Chain2 Cys6) Sequence Shortening Chain 1:{Maa}-{D-Tyr}-CGDCGGCGCGGC (Carba sulfide bridge:Maa1-Cys6); Chain 2:{Maa}-{D-Tyr}-CGDCGGCGCGGC (Carba sulfide bridge:Maa1-Cys6) (Covalent bridge:Chain1 Cys6-Chain2 Cys6)
Product Name Agalactoglyco peptide Biological activity Agalactoglyco peptide is an peptide. Agalactoglyco peptide can be used for the research of various biochemical. CAS Number 361443-82-5 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name Atriopeptin III (rat) Biological activity Atriopeptin III (ANP 127-150) (rat), a 24-amino acid atrial peptide, is a potent vasodilator and natriuretic/diuretic agent. Atriopeptin III (rat) improves renal functions and decreases blood pressure in a ureter-obstructed rat kidney model. Atriopeptin III (rat) can be used for research of chronic renal failure. CAS Number 90817-13-3…
Product Name BNP (1-21), Pro (Human) Biological activity BNP (1-21), Pro (Human) is a peptide containg 21 amino acids. B-Type Natriuretic Peptide (BNP), a cardiac natriuretic hormone. BNP together with the highly homologous atrial natriuretic peptide, it forms a dual natriuretic peptide system of the heart. BNP is responsible for changes in the heart organogenesis…
Product Name FC382K10W15 TFA Biological activity FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research. Sequence Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-{Lys(octadecanedioic acid monoacyl-γGlu-2xOEG)}-Ser-Lys-Tyr-Leu-Asp-Ser-Gln-Ala-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser Sequence Shortening Sequence Shortening HSQGTFTSD-{Lys(octadecanedioic acid monoacyl-γGlu-2xOEG)}-SKYLDSQAAQDFVQWLMNGGPSSGAPP Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name (D-Phe7)-Somatostatin-14 Biological activity (D-Phe7)-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS Number 64813-74-7 Sequence Sequence…
Product Name (Ser8)-GLP-1 (7-36) amide, human Biological activity (Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion. CAS Number…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us