OFFICIAL STATEMENT-Regarding Fraudulent Websites

store

  • Human (Myelin Basic Protein Isoform 5)

    Human (Myelin Basic Protein Isoform 5)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Neurodegeneration Layout: Freeze-dried in glass vial Organism: Human Protein Name: Myelin basic protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR Specifications:…

  • Human (Myelin Basic Protein)

    Human (Myelin Basic Protein)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease Layout: Freeze-dried in glass vial Organism: Human Protein Name: Myelin basic protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR…

  • Human (Myeloblastin)

    Human (Myeloblastin)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Granulomatosis, Inflammation, Wegener’s Disease Layout: Freeze-dried in glass vial Organism: Human Protein Name: Myeloblastin (PRTN3) Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification:…

  • Human (N-glycanase 1)

    Human (N-glycanase 1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools other Antigens Condition / Topic: Microcephaly Layout: Freeze-dried in glass vial Organism: Human Protein Name: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70%…

  • Human (NKX3-1)

    Human (NKX3-1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Prostate cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Homeobox protein Nkx-3.1 Purity: >70% (HPLC-MS), Development Grade: each…

  • Human (NY-ESO-1)

    Human (NY-ESO-1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Malignant genital cancers Layout: Freeze-dried in glass vial Organism: Human Protein Name: Cancer/testis antigen 1 (NY-ESO-1) Purity: >70% (HPLC-MS), Development…

  • Human (NY-ESO-2)

    Human (NY-ESO-2)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Malignant genital cancers Layout: Freeze-dried in glass vial Organism: Human Protein Name: Cancer/testis antigen 2 (NY-ESO-2) Purity: >70% (HPLC-MS), Development…

  • Human (P53)

    Human (P53)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Cellular tumor antigen p53 Purity: >70% (HPLC-MS), Development Grade: each peptide…

  • Human (PAP)

    Human (PAP)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Phosphatase, Prostate cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: >70% (HPLC-MS), Development…

  • Human (PD-L1)

    Human (PD-L1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Immune checkpoint Layout: Freeze-dried in glass vial Organism: Human Protein Name: Programmed cell death 1 ligand Purity: >70% (HPLC-MS), Development…

  • Human (PLAC1)

    Human (PLAC1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Placenta-specific protein 1 Purity: >70% (HPLC-MS), Development Grade: each peptide purified…

  • Human (Prame/OIP4)

    Human (Prame/OIP4)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Melanoma Layout: Freeze-dried in glass vial Organism: Human Protein Name: Melanoma antigen preferentially expressed in tumors (PRAME/OIP4) Purity: >70% (HPLC-MS),…

  • Human (Prostate-specific antigen PSA)

    Human (Prostate-specific antigen PSA)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Prostate cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Prostate-specific antigen Purity: >70% (HPLC-MS), Development Grade: each peptide…

  • Human (PSCA)

    Human (PSCA)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Prostate stem cell antigen Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence:…

  • Human (PSMA)

    Human (PSMA)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Alzheimer’s disease, Breast cancer, Cancer, Epithelium, Gastric cancer, Malignant genital cancers, Melanoma, Neurodegeneration, Prostate cancer Layout: Freeze-dried in glass vial Organism:…

  • Human (SOX-2)

    Human (SOX-2)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Microphthalmia syndromic type 3 Layout: Freeze-dried in glass vial Organism: Human Protein Name: Transcription factors/activators Purity: >70% (HPLC-MS), Development Grade:…