Insert HTML here
Showing 817–832 of 3705 results
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: BK Polyomavirus (BKV) Protein Name: Large T antigen Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KMEQDVKVAHQPDFG-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: BK Polyomavirus (BKV) Protein Name: Large T antigen Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-TFSRMKYNICMGKCI-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: BK Polyomavirus (BKV) Protein Name: Capsid protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-LLMWEAVTV-OH Specifications: 9mer peptide as TFA salt
BMAP 28, bovine is an antimicrobial peptide. BMAP 28, bovine expresses antibacterial activity against Gram-positive and Gram-negative bacteria by increasing cell membrane permeability and causing leakage of cellular contents. BMAP 28, bovine shows cytotoxicity against cancer cells and activated human lymphocytes. BMAP 28, bovine induces apoptosis through mitochondrial membrane potential depolarization. Product Details Product Name…
BMAP-18 is a biologically active peptide (BMAP-18 is a truncated form of the antimicrobial peptide BMAP-27. Bovine myeloid antimicrobial peptide-27 (BMAP-27) belongs to the cathelicidin peptide family and has rapid bactericidal activity against Staphylococcus aureus, Streptococcus uberis, and Escherichia coli. BMAP-27 is cytotoxic to human erythrocytes and neutrophils, although at concentrations higher than its bactericidal…
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Cattle Protein Name: Cathelicidin Purity: >95% (HPLC-MS) Quantification: No Sequence: H-GRFKRFRKKFKKLFKKLS-OH Specifications: Antimicrobial peptide
BMAP-27 is a cationic amphipathic ??-helical antimicrobial peptide with anticancer activity. BMAP-27 disrupts the integrity and permeability of cell membranes, causing leakage of intracellular DNA, proteins, and alkaline phosphatase. BMAP-27 increases intracellular ROS levels and reduces plasma endotoxin and TNF-?? concentrations. BMAP-27 can be used in research on Salmonella infection, breast cancer, lung cancer, and…
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Cattle Protein Name: Cathelicidin Purity: >95% (HPLC-MS) Quantification: No Sequence: H-GRFKRFRKKFKKLFKKLSPVIPLLHLG-OH Specifications: Antimicrobial peptide
BMAP-28 is an antibiotic peptide and a mitochondrial permeability transition pore inducer. BMAP-28 can induce cell death by opening the mitochondrial permeability transition pore. BMAP-28 can be used in research on microbial infections and cancer. Product Details Product Name BMAP-28 Biological activity BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition…
Product Name Auriculin A Biological activity Auriculin A is a synthetic atrial natriuretic factor (ANF) with hemodynamic effect. Auriculin A antagonizes renal vasoconstriction in the dog, and influences on arterial baroreflex control of heart rate, systemic blood pressure, and perfusion pressure in the hind limb (perfused at constant flow) in rabbits. Formula Formula C104H168N38O33S2 CAS…
Product Name Auriculin B Biological activity Auriculin B (ANP (126-150) (Rat)) is a rat-derived atrial natriuretic peptide. Auriculin B has potent vasodilatory and diuretic properties. CAS Number 90052-57-6 Sequence Shortening Sequence Shortening RSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge:Cys4-Cys20) Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Product Name GIP (22-51) human Biological activity GIP (22-51) human (Glucose-dependent Insulinotropic Peptide (22-51) human) is a potent proatherosclerotic peptide hormone consisting of 30 amino acids. GIP (22-51) human can activate the NF-??B signaling pathway, promote the expression of MMP-8, and induce the expression of proinflammatory and proatherosclerotic proteins. GIP (22-51) human can also increase…
Product Name CRSP-1 Biological activity CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast. CAS Number 697327-12-1 Sequence Sequence Ser-Cys-Asn-Thr-Ala-Thr-Cys-Met-Thr-His-Arg-Leu-Val-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Ser-Met-Val-Arg-Ser-Asn-Leu-Leu-Pro-Thr-Lys-Met-Gly-Phe-Lys-Val-Phe-Gly-NH2 (Disulfide bridge: Cys2-Cys7) Sequence Shortening Sequence Shortening SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG-NH2 (Disulfide bridge: Cys2-Cys7) Storage Please store the product under the recommended conditions in the Certificate of…
Product Name [Ala2,8,9,11,19,22,24,25,27,28]-VIP Biological activity -VIP is an analog vasoactive intestinal polypeptide (VIP) with high affinity and selectivity for human VIP/pituitary adenylate cyclase-activating polypeptide 1 (hVPAC1). VIP is a widespread neurotransmitter. CAS Number 866552-34-3 Sequence Sequence His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-NH2 Sequence Shortening Sequence Shortening HADAVFTAAYARLRKQMAAKKALAAIAA-NH2 Storage Please store the product under the recommended conditions in the Certificate of…
Bombesin, a tetradecapeptide, plays an important role in the release of gastrin and the activation of G-protein receptors. Product Information Product Name Bombesin Molecular Weight 1619.85 Formula C71H110N24O18S CAS Number 31362-50-2 Appearance Solid Color White to off-white Sequence {Glp}-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Sequence Shortening {Glp}-QRLGNQWAVGHLM-NH2 Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C…
Bombinin is an antimicrobial peptide derived from the frog Bombina variegata. Bombinin has a protective effect on aminopeptidase. Product Details Product Name Bombinin Biological activity Bombinin is an antimicrobial peptide derived from frog Bombina variegata. Bombinin has a protective effect on aminopeptidase. Sequence Shortening GIGALSAKGALKGLAKGLAEHFAN-NH2 Storage Please store the product under the recommended conditions in…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us