Showing 545–560 of 1666 results
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Escherichia coli Protein Name: Beta-galactosidase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-TPHPARIGL-OH Specifications: 9mer peptide as TFA salt
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Heloderma suspectum Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Feline endogenous virus ECE1 Protein Name: Envelope glycoprotein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KSPWFTTL-OH Specifications: 8mer peptide as TFA salt
Amount: 5 mg Application: B-cell Immunity, Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: Biotin-DYKDDDDK-OH
Amount: 5 mg Application: Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-DYKDDDDK-OH
Amount: 20 mg net (AAA) Application: Drug delivery, Tissue engineering Category: Hydrogel Forming Peptides Condition / Topic: Regenerative medicine Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Self-assembling peptide Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: Yes Sequence: Fmoc-FF-OH (synthetic)
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Fibroblast growth factor 2 Purity: >90% (HPLC-MS) Quantification: No Sequence: H-DPHIKLQLQAE-OH Specifications: 11mer cancer peptide
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Triticum aestivum Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GIIQPEQPAQL-OH Specifications: 11mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Breast cancer, Lung cancer, Multiple sclerosis, Ovarian cancer Layout: Freeze-dried in glass vial Organism: Triticum aestivum Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-WPQQQPFPQPQQPFCQQPQR-OH Specifications: 20mer peptide as TFA salt
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Hepatitis Layout: Freeze-dried in glass vial Organism: Hepatitis C Virus (HCV) Protein Name: Genome polyprotein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-YLVAYQATV-OH Specifications: 9mer peptide as TFA salt
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-GS-Ser(n-Octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR-OH
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Glucagon Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH
Amount: 0.5 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: GLP-1 Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
Amount: 0.5 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: GLP-1 Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Amount: 0.5 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: GLP-1 Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us
