Showing 529–544 of 1666 results
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation Specifications: Defined HLA class I-restricted T-cell epitopes
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Enhanced green fluorescent protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK…
Amount: 5 mg Application: B-cell Immunity, Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: Biotin-EPEA-OH
Amount: 5 mg Application: B-cell Immunity, Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-SEPEA-OH
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Fish Protein Name: epinecidin-1 prepropeptide Purity: >95% (HPLC-MS) Quantification: No Sequence: H-GFIFHIIKGLFHAGKMIHGLV-OH Specifications: Antimicrobial peptide
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Middle Eastern Respiratory Syndrome (MERS), Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: MERS-CoV (Middle East respiratory…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: SARS-CoV (Severe acute respiratory syndrome coronavirus) Protein Name: Spike…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 3 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…
Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Escherichia coli Protein Name: Beta-galactosidase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-DAPIYTNV-OH Specifications: 8mer peptide as TFA salt
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us
