Vosoritide
Description
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research.
Product Information
| Product Name | Vosoritide |
| Molecular Weight | 4102.73 |
| Formula | C176H290N56O51S3 |
| CAS Number | 1480724-61-5 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39) |
| Sequence Shortening | PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39) |
| Storage | Sealed storage, away from moisture and light, under nitrogen Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
