Insert HTML here
Showing 3473–3488 of 3705 results
Product Name FK 33-824 Biological activity FK 33-824, a synthetic analogue of Met-enkephalin, is a selective agonist of the ??-opioid receptor (??-OR). CAS Number 64854-64-4 Sequence Sequence Tyr-dAla-Gly-MePhe-Met(O)-ol Sequence Shortening Sequence Shortening Y-dAla-G-N-Me-FM(O)-ol Storage Please store the product under the recommended conditions in the Certificate of Analysis.
SNF-8814 is a cholecystokinin analog. SNF-8814 can be used in digestive system related research. Product Information Product Name SNF-8814 Molecular Weight 1089.20 Formula C56H68N10O13 CAS Number 137442-16-1 Sequence Asp-{Tyr(Me)}-Phe-Gly-Trp-{N(Me)Nle}-Asp-Phe-NH2 Sequence Shortening D-{Tyr(Me)}-FGW-{N(Me)Nle}-DF-NH2
Product Name Neuromedin U-25 (human) Biological activity Neuromedin U-25 human is the active form of neuromedin U in human. Neuromedin U-25 human inhibits glucose-stimulated insulin secretion, which leads to early-onset obesity. Neuromedin U-25 serves as vasoconstrictor in human vascular beds. Formula Formula C141H203N41O38 CAS Number 312306-89-1 Appearance Solid Color White to off-white Sequence Sequence Phe-Arg-Val-Asp-Glu-Glu-Phe-Gln-Ser-Pro-Phe-Ala-Ser-Gln-Ser-Arg-Gly-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2…
Product Name Glucagon (1-29), FAM-labeled Biological activity Glucagon (1-29), FAM-labeled is a biological active peptide. (FAM labeled HY-P0082) Appearance Solid Color Light yellow to yellow Sequence Sequence {FAM}-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH Sequence Shortening Sequence Shortening {FAM}-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month…
Product Name Galanin (1-16), mouse, porcine, rat Biological activity Galanin (1-16), mouse, porcine, rat is an agonist of the hippocampal galanin receptor, with a Kd of 3 nM. Molecular Weight 1669.88 Formula Formula C78H116N20O21 CAS Number 125118-77-6 Sequence Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile Sequence Shortening Sequence Shortening GWTLNSAGYLLGPHAI Storage Please store the product under the recommended conditions in…
Product Name Brain Natriuretic Peptide-45, rat Biological activity Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency. Formula Formula C213H349N71O65S3 CAS Number 123337-89-3 Sequence Sequence Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys23-Cys39) Sequence Shortening Sequence Shortening SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys23-Cys39) Storage Please…
Product Name ACTH (1-13) Biological activity ACTH (1-13) is a 13-aa peptide, with cytoprotective effects in the model of ethanol induced gastric lesions in rats. Molecular Weight 1623.83 Formula Formula C75H106N20O19S CAS Number 22006-64-0 Appearance Solid Color White to off-white Sequence Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val Sequence Shortening Sequence Shortening SYSMEHFRWGKPV
Product Name pTH-Related Protein (1-34) (human,mouse,rat) Biological activity pTH-Related Protein (1-34) (human,mouse,rat) (pTHrP (1-34)) is a parathyroid hormone-related protein fragment. Binding of pTH-Related Protein (1-34) (human,mouse,rat) to PTH1R triggers cAMP/PKA and PKC signaling, PI3K-mediated Akt and ERK1/2 phosphorylation, NADPH oxidase-dependent ROS generation, and TGF-beta1 and p47phox expression. pTH-Related Protein (1-34) (human,mouse,rat) induces fibronectin upregulation, osteoblast…
SOR-C13, a carboxy-terminal truncated peptide, is a high-affinity TRPV6 antagonist with an IC50 value of 14 nM. TRPV6 is a non-voltage gated calcium channel that is associated with malignancy and poor prognosis in breast cancer. SOR-C13 has anticancer activity. Product Information Product Name SOR-C13 Molecular Weight 1565.81 Formula C72H116N20O19 CAS Number 1187852-48-7 Appearance Solid Color…
SOR-C13 acetate is the acetate salt form of SOR-C13 (HY-P1651). SOR-C13 acetate is an antagonist for transient receptor potential vanilloid 6 (TRPV 6), with an IC50 of 14 nM. SOR-C13 acetate inhibits tumor growth in SKOV-3 xenograft mouse model. Product Information Product Name SOR-C13 acetate Molecular Weight 1565.81 (free acid) Formula C72H116N20O19.xC2H4O2 Appearance Solid Color…
SOR-C13 TFA, a carboxy-terminal truncated peptide, is a high-affinity TRPV6 antagonist with an IC50 value of 14 nM. TRPV6 is a non-voltage gated calcium channel that is associated with malignancy and poor prognosis in breast cancer. SOR-C13 TFA has anticancer activity. Product Information Product Name SOR-C13 TFA Molecular Weight 1565.81 (free acid) Formula C72H116N20O19.xC2HF3O2 Appearance…
Soralimixin (BRII-693), a Polymyxin derivative, is a next-generation intravenous (IV)-administered synthetic macrocyclic peptide antibiotic. Soralimixin can be used for the study of infections caused by drug-resistant Gram-negative pathogens. Product Information Product Name Soralimixin Molecular Weight 1160.15 Formula C48H80Cl2N16O13 CAS Number 1814918-91-6 Sequence {Dab(2,4-dichlorobenzaldehyde)}-{Thr}-{Dpr}-{Dab}-{Dab}-{d-Leu}-{Abu}-{Dab}-{Dab}-{Thr} (Lactam bridge: Dab4-Thr10) Sequence Shortening {Dab(2,4-dichlorobenzaldehyde)}-{Thr}-{Dpr}-{Dab}-{Dab}-{d-Leu}-{Abu}-{Dab}-{Dab}-{Thr} (Lactam bridge: Dab4-Thr10)
soVIRIP is a viral inhibitory peptide with an IC50 of 1.2 ??M against HIV-1. soVIRIP binds to the HIV-1 GP41 fusion peptide, inhibiting viral fusion and entry into host cells. soVIRIP has broad-spectrum anti-HIV-1 activity and is non-toxic in zebrafish models. soVIRIP can be used in research on viral infections. Product Details Product Name soVIRIP…
SP-B peptide is an antimicrobial peptide. SP-B peptide has antifungal activity against Cryptococcus neoformans, Candida albicans, and Aspergillus fumigatus strains. Product Details Product Name SP-B peptide Biological activity SP-B peptide is an antimicrobial peptide. SP-B peptide has antifungal activity against strains of Cryptococcus neoformans, Candida albicans and Aspergillus fumigatus Sequence Ala-Pro-Pro-Gly-Ala-Arg-Pro-Pro-Pro-Gly-Pro-Pro-Pro-Pro-Gly-Pro-Pro-Pro-Pro-Gly-Pro Sequence Shortening APPGARPPPGPPPPGPPPPGP Storage…
Product Name SP2 Biological activity SP2 is a 14-amino acid long active peptide that can induce growth arrest in MTLa cells of the mating type locus of Candida albicans. Formula Formula C78H109N19O20 CAS Number 678138-45-9 Sequence Sequence Gly-Phe-Arg-Leu-Thr-Asn-Phe-Gly-Tyr-Phe-Glu-Pro-Gly-Lys Sequence Shortening Sequence Shortening GFRLTNFGYFEPGK Storage Please store the product under the recommended conditions in the Certificate…
Product Name Tnrnflrfamide Biological activity Tnrnflrfamide is a neuropeptide that modulates the receptor muscles of the lobster abdominal stretch receptors and their exoskeletal muscle homologues. Tnrnflrfamide enhances motor performance, including the amplitude of excitatory postsynaptic potentials and the development of nerve-evoked tension. CAS Number 113611-68-0 Sequence Sequence Thr-Asn-Arg-Asn-Phe-Leu-Arg-Phe-NH2 Sequence Shortening Sequence Shortening TNRNFLRF-NH2 Storage Please…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us