Insert HTML here
Showing 81–96 of 490 results
Bombesin, a tetradecapeptide, plays an important role in the release of gastrin and the activation of G-protein receptors. Product Information Product Name Bombesin Molecular Weight 1619.85 Formula C71H110N24O18S CAS Number 31362-50-2 Appearance Solid Color White to off-white Sequence {Glp}-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Sequence Shortening {Glp}-QRLGNQWAVGHLM-NH2 Storage Sealed storage, away from moisture and light Powder -80??C 2 years -20??C…
BPC 157 is an orally active peptide. BPC 157 exhibits multiple activities such as promoting wound healing, tendon healing, neuroprotection, and gastrointestinal protection. BPC 157 can be used in the research of tendon injury, burn, gastric ulcer, and neurological diseases. Product Information Product Name BPC 157 Molecular Weight 1419.54 Formula C62H98N16O22 CAS Number 137525-51-0 Appearance…
BPC 157 acetate is an orally active peptide. BPC 157 acetate exhibits multiple activities such as promoting wound healing, tendon healing, neuroprotection, and gastrointestinal protection. BPC 157 acetate can be used in the research of tendon injury, burn, gastric ulcer, and neurological diseases. Product Information Product Name BPC 157 acetate Molecular Weight 1419.54 (free acid)…
Bradykinin is an effective endothelium-dependent vasodilator that can lower blood pressure. Bradykinin can induce contraction of bronchial and intestinal non-vascular smooth muscle, increase vascular permeability, and participate in the mechanism of pain. Product Information Product Name Bradykinin Molecular Weight 1060.21 Formula C50H73N15O11 CAS Number 58-82-2 Appearance Solid Color White to off-white Sequence Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg Sequence Shortening…
Bradykinin acetate is an effective endothelium-dependent vasodilator that can lower blood pressure. Bradykinin acetate can induce contraction of bronchial and intestinal non-vascular smooth muscle, increase vascular permeability, and participate in the mechanism of pain. Product Information Product Name Bradykinin acetate Molecular Weight 1060.21 (free base) Formula C52H77N15O13.xC2H4O2 CAS Number 6846-03-3 Appearance Solid Color White to…
Bremelanotide (PT-141) is a melanocortin receptor agonist. Bremelanotide can activate MC4R and increases dopamine release. Bremelanotide induces appetitive sexual behaviors, female mounting behavior, and repetitive self-grooming. Bremelanotide can be used for the research of hypoactive sexual desire disorders. Product Information Product Name Bremelanotide Molecular Weight 1025.16 Formula C50H68N14O10 CAS Number 189691-06-3 Appearance Solid Color White…
Bremelanotide (PT-141) Acetate is a melanocortin receptor agonist. Bremelanotide Acetate can activate MC4R and increases dopamine release. Bremelanotide Acetate induces appetitive sexual behaviors, female mounting behavior, and repetitive self-grooming. Bremelanotide Acetate can be used for the research of hypoactive sexual desire disorders. Product Information Product Name Bremelanotide Acetate Molecular Weight 1085.22 Formula C52H72N14O12 CAS Number…
Brenipatide (LY-3537031) is a dual agonist of glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP). Brenipatide is used in research on alcohol use disorder, bipolar disorder, smoking cessation, and other conditions. Product Information Product Name Brenipatide Molecular Weight 4891.52 Formula C228H354N46O72 CAS Number 2408921-49-1 Appearance Solid Color White to light yellow Sequence {d-Tyr}-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{Leu(aMe)}-Leu-Asp-Lys-{Lys(AEEA-AEEA-γGlu-C20 diacid)}-Ala-Gln-{Aib}-Glu-Phe-Ile-Glu-{Tyr(aMe)}-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Sequence…
Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research. Product Information Product Name Bulevirtide Molecular Weight 5398.86 Formula C248H355N65O72…
BW-180C (-Enkephalin; DADLE) is an δ opioid receptor (DOR) agonist, which belongs to the enkephalin family. Neuroprotective agent. BW-180C reversibly inhibits cellular transcription in neurons without causing cell injury. Product Information Product Name BW-180C Molecular Weight 569.65 Formula C29H39N5O7 CAS Number 63631-40-3 Appearance Solid Color White to off-white Storage Sealed storage, away from moisture Powder…
C-VGB3 is a selective vascular endothelial growth factor receptor 2 (VEGFR2) antagonist, which inhibits VEGFR2-mediated PI3K/AKT/mTOR and PLCγ/ERK1/2 signaling pathways. C-VGB3 binds to the extracellular domain of VEGFR2, blocking ligand-receptor interaction and inducing apoptosis in endothelial and tumor cells through both intrinsic (involving Bcl2 family and caspases) and extrinsic (death receptor-mediated) pathways. C-VGB3 is promising…
Caerulein is a decapeptide and a potent cholecystokinin receptor agonist. Caerulein is a safe and effective cholecystokinetic agent with a direct spasmogenic effect on the gallbladder muscle and bile ducts. Product Information Product Name Caerulein Molecular Weight 1352.41 Formula C58H73N13O21S2 CAS Number 17650-98-5 Appearance Solid Color White to off-white Sequence {pGlu}-Gln-Asp-Tyr(SO3H)-Thr-Gly-Trp-Met-Asp-Phe-NH2 Sequence Shortening {pGlu}-QD-Y(SO3H)-TGWMDF-NH2 Storage…
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity. Product Information Product Name Cagrilintide Molecular Weight 4409.01 Formula C194H312N54O59S2 CAS Number 1415456-99-3 Appearance Solid…
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies. Product Information Product Name Cagrilintide acetate Molecular Weight 4409.01 (free base) Formula C194H312N54O59S2.xC2H4O2 Appearance Solid Color White to off-white…
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis. Product Information Product Name Calcitonin, eel Molecular Weight 3414.91 Formula C146H241N43O47S2 CAS Number 57014-02-5 Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)
Canvuparatide (MBX 2109) is a PTH analog prodrug that releases the biologically active peptide through temperature- and pH-controlled intramolecular cyclization. The peptide released by Canvuparatide binds to and activates the PTH1 receptor, stimulating dose-dependent cAMP accumulation. Canvuparatide can be used in research on hypoparathyroidism. Product Information Product Name Canvuparatide Molecular Weight 5873.83 Formula C263H441N65O81S2 CAS…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Therapeutic Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us