Insert HTML here
Showing 129–144 of 667 results
CAP 37 (20-44) is a peptide based on amino acid residues 20-44 of CAP37. CAP37 is a 37 kDa cationic antibacterial protein and a multifunctional protein. Product Details Product Name CAP 37 (20-44) Biological activity CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial…
CAP18 (rabbit) is a 37-amino-acid antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antibacterial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria and can be used in research on bacterial sepsis. Product Details Product Name CAP18 (rabbit) Biological activity CAP18 (rabbit) is a 37 amino acids antimicrobial…
Capreomycin is a macrocyclic peptide antibiotic. Capreomycin can be used in research against multidrug-resistant Mycobacterium tuberculosis. Capreomycin inhibits the synthesis of phenylalanine in mycobacterial ribosomal translation. Product Details Product Name Capreomycin Biological activity Capreomycin is a macrocyclic peptide antibiotic. Capreomycin can be used for anti-multidrug-resistant-tuberculosis research. Capreomycin can inhibit phenylalanine synthesis in in mycobacterial ribosomes…
Cathelicidin-2 chicken is an antimicrobial peptide. Cathelicidin-2 chicken has strong bactericidal and fungicidal activity against chicken-specific Salmonella isolates. Product Details Product Name Cathelicidin-2 (chicken) Biological activity Cathelicidin-2 chicken is antimicrobial peptide. Cathelicidin-2 chicken shows potent bactericidal and fungicidal activity against chicken-specific salmonella isolates. Sequence Arg-Phe-Gly-Arg-Phe-Leu-Arg-Lys-Ile-Arg-Arg-Phe-Arg-Pro-Lys-Val-Thr-Ile-Thr-Ile-Gln-Gly-Ser-Ala-Arg-Phe-NH2 Sequence Shortening RFGRFLRKIRRFRPKVTITIQGSARF-NH2 Storage Please store the product under the…
Cathelicidin-PY is an antimicrobial peptide with potent antimicrobial activity. Cathelicidin-PY inhibits the activation of the lipopolysaccharide (LPS) (HY-D1056)-induced TLR4 inflammatory pathway. Cathelicidin-PY has strong antibacterial and anti-inflammatory activities and low cytotoxicity against RAW 264.7 cells. Cathelicidin-PY can be used in antibacterial and anti-inflammatory research. Product Details Product Name Cathelicidin-PY Biological activity Cathelicidin-PY is an antimicrobial…
Cathepsin G(1-5) is an antimicrobial peptide present in a clostripain-digested cathepsin G mixture. Product Details Product Name Cathepsin G(1-5) Biological activity Cathepsin G(1-5) is an antimicrobial peptide that can be found in the clostripain-digested cathepsin G mixture. Sequence Ile-Ile-Gly-Gly-Arg Sequence Shortening IIGGR Storage Please store the product under the recommended conditions in the Certificate of…
CBP-1018 is a PDC (peptide-drug conjugate) formed by conjugating Monomethyl auristatin E (HY-15162) with a FLOR1/PSMA (prostate-specific membrane antigen) dual-targeting ligand via a linker (HY-78738). CBP-1018 binds FLOR1 and prostate-specific membrane antigen (PSMA). CBP-1018 can be used in research on solid tumors and metastatic castration-resistant prostate cancer. Product Details Product Name CBP-1018 Biological activity CBP-1018…
CEC-2-9 is a polypeptide with the sequence Ac-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQA{S5}QIA{S5}-NH2. Product Details Product Name CEC-2-9 Biological activity CEC-2-9 is a polypeptide with the sequence Ac-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQA{S5}QIA{S5}-NH2. Sequence Shortening Ac-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQA{S5}QIA{S5}-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Cecropin A is a linear polypeptide composed of 37 amino acids, with antibacterial, anti-tumor and anti-inflammatory activities. Product Details Product Name Cecropin A Biological activity Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity. Formula C184H313N53O46 CAS Number 80451-04-3 Appearance Solid Color White to off-white Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 Sequence Shortening KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Storage…
Cecropin A (1-7)-Melittin A (2-9) is an antimicrobial peptide with antibacterial activity against a broad spectrum of Gram-positive and Gram-negative aerobic bacteria, as well as antimalarial activity, and lacks the adverse hemolytic properties of melittin. Product Details Product Name Cecropin A (1-7)-Melittin A (2-9) Biological activity Cecropin A (1-7)-Melittin A (2-9) is an antimicrobial peptide…
Cecropin A TFA is a linear antimicrobial peptide composed of 37 amino acid residues obtained from Hyalophora cecropia pupae, with antibacterial, anti-inflammatory, and anticancer effects. Product Details Product Name Cecropin A TFA Biological activity Cecropin A TFA is a linear 37-residue antimicrobial polypeptide isolated from Hyalaphora cecropia pupae. Cecropin A TFA exhibits anti-bacterial, anti-inflammatory and…
Cecropin B possesses a high level of antibacterial activity and is a valuable peptide antibiotic. Product Details Product Name Cecropin B Biological activity Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic. Molecular Weight 3834.67 Formula C176H302N52O41S CAS Number 80451-05-4 Appearance Solid Color White to off-white Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2…
Cecropin B (free acid) is a polypeptide that can be discovered by peptide screening. Peptide screening is a research tool that primarily collects active peptides through immunoassays. Peptide screening can be used in protein interaction, functional analysis, and antigen epitope screening, especially in the field of active molecule research and development. Product Details Product Name…
Cecropin D is an antimicrobial peptide with an MIC of 4.55 ??g/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, anti-tumor, and immunomodulatory effects. Product Details Product Name Cecropin D Biological activity Cecropin D is an antimicrobial peptide with a MIC of 4.55 ??g/mL. Cecropin D is effective…
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the porcine small intestine. Cecropin P1, porcine has antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine has antiviral activity and inhibits PRRSV infection. Product Details Product Name Cecropin P1, porcine Biological activity Cecropin P1, porcine is an antibacterial peptide…
Cecropin P1, porcine acetate is an antibacterial peptide that can be isolated from the upper part of the porcine small intestine. Cecropin P1, porcine acetate has antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine acetate has antiviral activity and inhibits PRRSV infection. Product Details Product Name Cecropin P1, porcine acetate Biological activity Cecropin P1, porcine…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Antimicrobial Peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us