CAP18 (rabbit)
Description
CAP18 (rabbit) is a 37-amino-acid antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antibacterial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria and can be used in research on bacterial sepsis.
Product Details
| Product Name | CAP18 (rabbit) |
| Biological activity | CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research. |
| CAS Number | 152742-15-9 |
| Sequence Shortening | GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
