Exendin(9-39) amide acetate
Description
Exendin (9-39) amide acetate (Avexitide acetate) is a competitive GLP-1R antagonist. Exendin (9-39) amide acetate blocks the Semaglutide (HY-114118)-induced increase in insulin secretion and also attenuates the hypoglycemic effect of Semaglutide. Exendin (9-39) amide acetate abolishes the islet-protective effect of Liraglutide. Exendin (9-39) amide acetate can be used in research on type 2 diabetes and type 1 diabetes.
Product Information
| Product Name | Exendin(9-39) amide acetate |
| Molecular Weight | 3369.76 (free base) |
| Formula | C149H234N40O47S??xC2HF3O2 |
| CAS Number | 2051593-46-3 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Sequence Shortening | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Storage | Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture) |
